KEGG   Pandoraea norimbergensis: AT302_09025Help
Entry
AT302_09025       CDS       T04226                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00970  Aminoacyl-tRNA biosynthesis
pnr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AT302_09025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pnr03029]
    AT302_09025
Enzymes [BR:pnr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AT302_09025
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AT302_09025
Mitochondrial biogenesis [BR:pnr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AT302_09025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF2120 DUF4702
Motif
Other DBs
NCBI-ProteinID: ALS59877
UniProt: A0A0U2Y4T8
Position
227286..227585
Genome map
AA seq 99 aa AA seqDB search
MALNLSDVKRIAHLARLELADDEAAHMEKELNGFFALVEQMQSVDTTGVAPLAHPIEQIQ
AVAQRLRTDAVTEVVDRDANQRPAPAVQDGLYLVPKVIE
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaatctctccgacgtcaaacgcatcgcccatctcgcacgtctggagctggcg
gatgacgaggcggctcacatggaaaaggagctcaacggcttcttcgcgctcgtcgagcag
atgcaatcggtcgacacgacaggcgtcgctcccctcgcgcatcccatcgagcaaattcaa
gcagttgcccaacgactgcgtaccgatgccgtgaccgaagtggtcgatcgcgacgcgaat
cagcgcccggcacctgcggttcaggacggcctttatctggtgccgaaggttatcgagtga

DBGET integrated database retrieval system