KEGG   Pandoraea norimbergensis: AT302_13335
Entry
AT302_13335       CDS       T04226                                 

Definition
(GenBank) hypothetical protein
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00621  Dioxin degradation
pnr01100  Metabolic pathways
pnr01120  Microbial metabolism in diverse environments
pnr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    AT302_13335
Enzymes [BR:pnr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     AT302_13335
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: ALS60619
UniProt: A0A0U2Y0E6
Position
1163328..1164146
AA seq 272 aa
MGKIVSAAATSHTFGVADGVEAQAQRIFDGIDRIGQAIQASRPDVILIATSDHLVNFSLD
FQIPLAVGISDDWCPYGDLGVPRQPFPGHREFATELVAFAATKHFDLAAVENVKPDHGLA
MPNAIINRGSNVPVVPIYINTVMTPAPTCARSFALGKAVREYVETARPANERVAILATGG
LSHWICLPDSGRVNAEWDRALIERVVSGRGAELAELSFDAIMKDGGNGGLEMATWAFMAG
TTGDSVGECVYYEEMTAWWTGMGGVLMHLDGA
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggaaagattgttagtgcggcggccacctctcacacgtttggcgtggcggacggggtg
gaggcgcaagcgcagcgcatcttcgacggcatcgaccggattggacaggcgattcaggcg
tccagacccgatgtgatcctgattgccaccagcgaccatctggtcaatttctcgctggat
ttccagattccgctcgcggtcggcatctctgacgattggtgtccctacggcgatcttggc
gtgccacggcagccgttcccggggcaccgggaatttgccaccgaactcgtcgcgtttgcg
gccaccaagcacttcgatctcgctgcggtcgagaacgtgaagccggatcacgggctggcg
atgccgaacgcgatcatcaatcgcggctcgaacgtgccggtggtgccgatctacatcaat
accgtgatgacaccggcgccgacgtgtgcccgcagtttcgctttagggaaagcggtgcgg
gagtatgtggagactgcgcgtcccgcgaacgagcgtgtcgcaattctagcgacgggcggg
ctctcgcactggatctgcttacccgattcaggacgcgtgaatgcggagtgggaccgcgcg
ttaatcgagcgggtcgtttcaggccgtggtgctgaactggcggaactgtccttcgacgca
atcatgaaggatggcgggaacggcggacttgagatggccacgtgggcattcatggccggc
accactggagatagcgtgggcgaatgcgtctattacgaggaaatgacggcgtggtggacc
ggcatgggcggcgtgctcatgcatctggatggggcgtga

DBGET integrated database retrieval system