KEGG   Pandoraea norimbergensis: AT302_17565Help
Entry
AT302_17565       CDS       T04226                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00020  Citrate cycle (TCA cycle)
pnr00310  Lysine degradation
pnr00380  Tryptophan metabolism
pnr01100  Metabolic pathways
pnr01110  Biosynthesis of secondary metabolites
pnr01120  Microbial metabolism in diverse environments
pnr01130  Biosynthesis of antibiotics
pnr01200  Carbon metabolism
Module
pnr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT302_17565
  09105 Amino acid metabolism
   00310 Lysine degradation
    AT302_17565
   00380 Tryptophan metabolism
    AT302_17565
Enzymes [BR:pnr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AT302_17565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALS61313
UniProt: A0A0U2YCK0
Position
2109200..2110459
Genome map
AA seq 419 aa AA seqDB search
MAIVEVKVPQFSESVSEGTLLDWKKKVGEAIAQDETVIEVETDKVVLEVPAPAAGVLVEV
TASAGDTVTSEQIIAKIDTEAKAGAAAPVAAKPAEAAAPAAAPAAAAATGGASGGIASPA
AAKVLAEKNLSATDVAGSGRDGRVTKGDALAAGAAKPAAAASIPAPAQRASLPSVAAAVG
RDTSLEGRPEQRVPMSRLRARIAERLLQSQQTNAILTTFNEVDMKPVMDLRNKYKDKFEK
EHGVKLGFMSFFVKAAVHALKKYPAVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRN
ADQMSLADIEKKIAEYGKKAADGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAIL
GVHATKERAVVVNGEIVIRPMNYLAMSYDHRIIDGREAVLSLVAMKEALEDPARLLLDL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccattgttgaagtcaaagtcccccagttttccgagtcggtttccgaaggcaccctg
ctcgactggaagaaaaaagtcggcgaagccatcgcccaagatgaaaccgtgatcgaagtc
gagaccgacaaggtcgtgctcgaagtgccggccccggccgcaggtgtgctcgtcgaagtg
acggccagcgctggcgacacggtgacgtcggaacaaatcatcgccaagatcgacaccgaa
gccaaggcaggcgctgctgcaccggtcgccgccaagccggcggaagccgctgcaccggcc
gctgctcccgcagccgctgctgccacgggtggtgcttcgggtggcatcgccagcccggcc
gctgccaaggtgctggccgagaagaacctgtcggcaaccgacgttgccggctcgggccgc
gacggccgcgtgaccaagggcgacgccctggccgccggtgccgccaagccggctgctgct
gcttcgatcccggccccggcgcaacgcgcctcgctgccgtcggtcgctgctgccgttggc
cgcgacacgtcgctggaaggccgtccggaacagcgcgtgccgatgtcgcgtctgcgcgcc
cgtatcgccgagcgcctgctgcaatcgcaacagaccaacgccattctgaccacgttcaac
gaagtggacatgaagccggtgatggacctgcgcaacaagtacaaggacaagttcgagaag
gaacacggcgtgaagctgggtttcatgtcgttcttcgtcaaggccgctgtgcacgcgctc
aagaagtacccggccgtgaacgcctcgatcgacggtaacgacatcgtctaccacggctac
ttcgacatcggtatcgctgtcggttcgccgcgtggtctggtggtgccgattctgcgcaat
gccgaccagatgagcctggccgacatcgagaagaagatcgccgagtacggcaagaaggct
gccgacggcaagctgtcgatcgaagaaatgaccggcggtacgttctcgatctcgaacggc
ggtgtgttcggctcgatgctgtcgaccccgattatcaacccgccgcagtcggccattctt
ggcgtgcacgccacgaaggaacgcgctgtcgtggtgaacggcgagatcgtcatccgtccg
atgaactatctggccatgagctacgaccaccgcatcatcgacggccgcgaagccgtgctg
agcctcgtcgccatgaaggaagcgctggaagatccggcgcgcctgctgctcgacctgtaa

DBGET integrated database retrieval system