KEGG   Pandoraea norimbergensis: AT302_25890Help
Entry
AT302_25890       CDS       T04226                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00260  Glycine, serine and threonine metabolism
pnr01100  Metabolic pathways
pnr01110  Biosynthesis of secondary metabolites
pnr01120  Microbial metabolism in diverse environments
pnr01130  Biosynthesis of antibiotics
pnr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT302_25890
Enzymes [BR:pnr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AT302_25890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALS62719
UniProt: A0A0U2WFL0
Position
complement(4055859..4056953)
Genome map
AA seq 364 aa AA seqDB search
MTQRNTEHVVDLRSDTVTRPTALMWEAMQTASLGDDTLEGDPTVRALEHLAAVATGKEEA
MFVVSGTMGNLIASLCHATRGGEAVIDAQAHMAKSEAGGMSRLAHLYPVTIPSVRGEMDL
DALAGALRPGFSRYGQPTAMVGVESTHNHSGGYVPSLAYLADVHSLASRAGVPVHLDGAR
VFNAAAALGVDAATIATHCESLTFCLSKGLSAPMGAMLVGSHALIEQARTFRRMVGGGLR
QAGIMAAAGKVAMETMVARLADDNHRAHRLWTGLAAIDPLLVDTVPSHSNIVRLRVGEQR
ESDPRAWEAALAEYGILARASGQSMLRLVTHRHIGDDDIDETIAAIASIRDTFAAGASPV
LGVH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacgtaataccgaacacgtcgtcgatttgcgcagcgataccgttacccggccg
accgcgctgatgtgggaggcgatgcaaaccgcctcgctcggcgacgacacgctggagggc
gacccgacggtgcgcgccctcgaacatctggcggcggtggccacgggcaaggaggaggcg
atgttcgtcgtctccggcacgatgggcaatctgatcgcctcgctgtgtcacgccacgcgc
ggtggcgaagccgtgatcgatgcgcaagctcacatggccaagtcggaggcgggcggcatg
tcgcgcctggcgcatctctatccggtgacgataccgtcggtgcgcggcgagatggatctc
gatgcattggccggggcactgcgccccggcttttcccgttatgggcaacccacggcgatg
gtcggcgtggagtcgacgcataaccactcgggcggctacgtgccgtcgctggcctatctg
gccgacgtgcattcgctggcgtcgcgtgcgggcgtgccggtgcatctggatggtgcgcgc
gtgttcaacgcggcggcggcgcttggcgtggatgccgcaacgatcgccacgcactgcgag
agcctgacgttctgtttgtcgaagggattgtcggcgccgatgggcgcgatgctggtgggc
tcgcacgcgctgatcgaacaggcacgcacgttccggcgcatggtcggtggcgggttgcgg
caggcgggcatcatggccgcagcgggcaaggtggcgatggagacgatggtggcgcgtctg
gccgatgacaatcaccgcgcgcatcgactctggaccggactggcggcaatcgatccgctg
ctcgtcgatacggtgccgtcgcacagcaatatcgtgcggctgcgcgtgggggagcagcgt
gagagcgacccgcgtgcgtgggaggcggcgctcgccgagtacggcattctggcgcgtgcc
agcggtcagtcgatgctgcggctcgtgacccaccgccatatcggcgacgacgacatcgac
gaaaccattgccgcgattgcttcgattcgcgacacgttcgccgcgggtgcgtcaccggtg
ctgggtgtgcactga

DBGET integrated database retrieval system