KEGG   Porphyrobacter neustonensis: A9D12_02605Help
Entry
A9D12_02605       CDS       T04416                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00361  Chlorocyclohexane and chlorobenzene degradation
pns00625  Chloroalkane and chloroalkene degradation
pns01100  Metabolic pathways
pns01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A9D12_02605
   00361 Chlorocyclohexane and chlorobenzene degradation
    A9D12_02605
Enzymes [BR:pns01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A9D12_02605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ANK12004
UniProt: A0A192D2L7
Position
complement(541618..542226)
Genome map
AA seq 202 aa AA seqDB search
MTMRKAAVFDVGRVLFDWQLRVLFEKLIADPQELDWFLANVVTEEWHFEHDQGRTMAEML
PERIALYPAQESLIRAYAARFNETIPGPVPGTHALVERLAARGVPLFCLTNFGDEFWQAF
RPTQPIFDHFADIIVSGVEKVAKPEARIYEIVERRSGRSGDALFFTDDNPANIAAARARG
WDAHLFTDAAALEAQLTGAGLL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcgcaaggccgcggtgttcgatgtggggcgggtgctgttcgactggcaactg
cgcgtcttgttcgaaaagctgatcgccgatccgcaagagctcgactggttccttgccaac
gttgtcaccgaggaatggcatttcgagcatgaccagggccggacgatggccgagatgctg
cctgagcgaatcgcgctctaccccgcgcaggaaagcctgatccgcgcctatgccgcgcgg
ttcaacgaaaccattcccgggcccgtccccggcacgcatgcgctggtcgaacggctggca
gcgcgcggcgtacccttgttctgcctgaccaatttcggcgacgagttctggcaggcgttc
cgcccgacacagccgatcttcgaccattttgcggatatcatcgtctccggcgtcgagaag
gtcgccaagcccgaggcgcgaatttacgagatcgtcgaacggcgcagcggtcgcagcggc
gacgccttgttcttcaccgacgacaatcccgccaacatcgccgcggcgcgtgcgcgcggc
tgggacgcgcacctgttcaccgatgccgccgcgctcgaagcgcagttgacgggtgccgga
ctgctgtaa

DBGET integrated database retrieval system