KEGG   Porphyrobacter neustonensis: A9D12_06715Help
Entry
A9D12_06715       CDS       T04416                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00071  Fatty acid degradation
pns00072  Synthesis and degradation of ketone bodies
pns00280  Valine, leucine and isoleucine degradation
pns00310  Lysine degradation
pns00362  Benzoate degradation
pns00380  Tryptophan metabolism
pns00620  Pyruvate metabolism
pns00630  Glyoxylate and dicarboxylate metabolism
pns00640  Propanoate metabolism
pns00650  Butanoate metabolism
pns00900  Terpenoid backbone biosynthesis
pns01100  Metabolic pathways
pns01110  Biosynthesis of secondary metabolites
pns01120  Microbial metabolism in diverse environments
pns01130  Biosynthesis of antibiotics
pns01200  Carbon metabolism
pns01212  Fatty acid metabolism
pns02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9D12_06715
   00630 Glyoxylate and dicarboxylate metabolism
    A9D12_06715
   00640 Propanoate metabolism
    A9D12_06715
   00650 Butanoate metabolism
    A9D12_06715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A9D12_06715
   00072 Synthesis and degradation of ketone bodies
    A9D12_06715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9D12_06715
   00310 Lysine degradation
    A9D12_06715
   00380 Tryptophan metabolism
    A9D12_06715
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9D12_06715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9D12_06715
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9D12_06715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pns04147]
    A9D12_06715
Enzymes [BR:pns01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9D12_06715
Exosome [BR:pns04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9D12_06715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ANK12685
UniProt: A0A192D3K5
Position
1427180..1428706
Genome map
AA seq 508 aa AA seqDB search
MIADNTPVIIGVGHYSERVGEPGYEALSYMDLAGRALSAAIADSAASGDVAGAIDTLAAI
RAFEMSRPDRKPPFGAADNVPRAIARRVGANPARAILTTTGGQTNQQLVGEFATVIAAGD
SACAVIVGSEAISTVLALSAKGETPDWSEAIGGDFEDQGFGVEELLEPALMAHGATGAIP
LYALAENARRHRLGMGLDEYRREIGKLFAPFTRVAAANPHSAAPVERSAEELAAITDRNR
IVAEPYPRMTVARDQVNQAAAVILASAGLARALGVPEDRWVHIHAVTAATELKLSQRPDL
SGNPASLASVDAALARAGKGIGDMAYLDFYSCFAIPVFNQCDHFGLTADDPRGLTLTGGL
PFFGGAGNNYSAHAIAEAVQRVRGDRGSFALVGANGGWMSKYATGIYSAVPADWSGNDRF
SVLPKATDTVPPARGPVENATVETYTINRSPRGDVAIFIGRTQAGERVVGNADLADPATA
QAFESGEPFGRWLALRQDERGRTTGRVA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgacaacacgcccgtcatcatcggggtggggcactattcggaacgggtcgga
gagcccggttacgaagccctgtcctatatggaccttgcagggcgcgccttgtcggcggcg
attgcggacagcgcggcgagcggtgacgtggcaggcgccatcgacacgctcgccgcgatc
cgcgccttcgaaatgtcgcggcccgaccggaaaccccccttcggcgcggcggacaatgta
ccgcgggcgattgccaggcgggtcggtgccaatcccgcgcgcgcgatcctgaccaccacc
ggcgggcagaccaaccagcagctggtgggcgaatttgcgaccgtgattgcggcgggcgac
agtgcttgcgcggtgatcgtcggctctgaggcgatttcgaccgtgctggcgctctcggcc
aagggtgagacccccgactggtcggaggccatcggcggcgatttcgaggatcagggcttc
ggggtcgaggaactgctcgaacctgcgctgatggcgcacggcgcgaccggggcgatcccg
ctttatgcactggccgagaacgcccggcggcaccggctgggcatggggctggacgaatac
cgccgcgaaatcggcaagctgtttgcgccctttacgcgcgtggcagcggcgaacccgcat
tcggcggcgccggtcgaacgcagcgcggaggagctcgccgcgatcaccgaccgcaaccgc
atcgtcgccgaaccctatccgcgcatgaccgtggcgcgcgatcaggtgaaccaggcggcg
gcggtcatccttgcctcggcgggccttgcgcgcgcgctcggcgtgccggaggacaggtgg
gtgcatatccacgccgtcaccgccgcgaccgagctgaagctctcgcagcggcccgatctg
tctggcaatccggcgagccttgcaagcgtcgatgcggcgctggcgcgggcggggaagggg
atcggcgacatggcctatctcgacttctactcgtgctttgcgatccccgtgttcaaccag
tgcgaccatttcggcctgacggcggacgacccgcgcgggctgacgctgaccggcggcctg
cccttcttcggcggggcggggaacaactactcggcccacgccatcgccgaagccgtgcag
cgcgtgcgcggcgaccggggctcgtttgccttggtcggcgcgaatggcggctggatgagc
aaatatgcgaccggcatctattcggcggtgccagccgactggagcgggaacgaccgcttc
tccgtgctccccaaggccaccgacacggtgccgcctgcgcgcgggccggtggagaacgcc
acggtcgaaacctacaccatcaaccgcagccccaggggcgatgtcgcgatcttcatcggc
cgcacgcaagcgggcgagcgggtggtgggcaatgccgatcttgccgaccctgctactgcg
caagcgttcgaaagtggagaacccttcggcaggtggctggcgctgaggcaggacgagcgc
gggcgcaccacggggcgggtcgcctga

DBGET integrated database retrieval system