KEGG   Porphyrobacter neustonensis: A9D12_12935Help
Entry
A9D12_12935       CDS       T04416                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00480  Glutathione metabolism
pns00590  Arachidonic acid metabolism
pns01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A9D12_12935
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A9D12_12935
Enzymes [BR:pns01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A9D12_12935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: ANK13700
UniProt: A0A192D6G2
Position
complement(2787504..2787983)
Genome map
AA seq 159 aa AA seqDB search
MTTIADFTVTTNRGQPLDLKDKLGTVLLVVNTASKCGFTPQYDGLEKLFQQYRDRGFEVL
GFPCNQFGAQEPGNADEIEQFCKVNFGVTFPLMEKVDVNGADASPLFDWMKSEKKGLMGT
SAIKWNFTKFLIDRQGRVVKRYAPTDKPEAIARDLEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgattgccgacttcaccgtcaccaccaatcgtggtcaaccgctcgatctcaag
gacaagctcggcaccgtgctcttggtggtcaacaccgcgagcaagtgcggtttcaccccg
caatatgacgggctcgaaaagctgtttcagcaataccgcgatcgcgggttcgaagtgctg
ggtttcccctgcaaccagttcggcgcgcaggaacccggcaatgccgacgagatcgaacag
ttctgcaaggtcaatttcggcgtcaccttcccgctgatggaaaaggtcgacgtcaacggc
gcggacgcctcgccgctgttcgattggatgaaatccgagaaaaagggcctcatgggcacc
agcgcgatcaagtggaatttcaccaagttcctgatcgaccggcaggggcgcgtggtcaaa
cgctacgcccccaccgacaagcccgaagcgattgcccgcgacctcgaaaagctgttgtga

DBGET integrated database retrieval system