KEGG   Polynucleobacter asymbioticus: Pnuc_0123Help
Entry
Pnuc_0123         CDS       T00502                                 

Definition
(GenBank) peptidase S1 and S6, chymotrypsin/Hap
Organism
pnu  Polynucleobacter asymbioticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ PDZ_6 Peptidase_S46 Peptidase_S32
Motif
Other DBs
NCBI-ProteinID: ABP33344
UniProt: A4SV30
Position
complement(118149..119321)
Genome map
AA seq 390 aa AA seqDB search
MFNRLWLLFAQSVTILLAAWFIVATLKPQWVSSPNQNLLERVTLKEGLYDGSSLSPGSYH
EAVKKSMPAVVNIFTNKNSSKPKTKKRNHSSDPLFKFFFGDEPPGEEPKSSLGSGVLVSP
EGVILTNHHVISDADEVEVSLADGRKFSAKLIGSDPETDIAVLKINAPSLPTPITFGEIE
SVYVGDIVLAIGNPFGVGQTVTSGIVSALGRDHVGINTFENFIQTDASINPGNSGGALVD
TRGNLIGINTAIYSNNGGSMGIGFAIPVNLAKQVMESILITGGVTRGWIGVEPQNLSKEL
SESLGLPANTEGVLLSGILEGGPAARGGAQPGDVLISVNDKPIMDVRQLLNQIAQIGPGN
TADLKVLRKNKTLDLKVQTGKRPKPTAVNQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatcgactttggttactgtttgcacaatcggtaaccattcttttagctgcttgg
ttcattgtggcaacactcaaacctcagtgggtcagctcacccaatcaaaatttattggaa
cgtgtgacactgaaagaagggctctatgacggcagctcattaagcccaggctcgtatcac
gaggcggtaaaaaaatcgatgcccgcagtggtgaatatttttaccaataaaaatagttct
aaaccaaaaactaaaaaaagaaatcattcatcagacccactatttaaattcttctttggg
gatgagcctccaggggaagagccaaaatctagccttgggtctggagttctagtgagtcct
gagggcgtcattctgactaaccatcatgtcatcagtgatgcagatgaagttgaagtctcg
cttgcagatggtagaaaattttccgcaaaactgattggtagcgatccagaaacagacatc
gctgttcttaaaattaatgccccctctttaccaacgcctattacttttggagagattgag
tcggtttatgtaggagatatagttttagcaattggcaatccttttggcgtagggcaaaca
gtcacatctggaatagtgtccgcccttggaagagatcatgtaggcattaatacatttgaa
aactttattcaaacagatgcctcaattaatcctggaaattctgggggcgccttggtcgat
actcgcggcaatttaattggcattaacactgcaatttattcaaacaatggtggctccatg
ggcattggctttgctattccagtcaatcttgcaaaacaagtgatggagtccattttgata
actggcggcgttactaggggatggatcggagtagagcctcaaaatctttctaaagagctc
tccgagtcgcttgggctaccagctaataccgaaggtgttctgttgtctggaattcttgag
ggagggcctgctgctcgaggcggcgcacaaccaggtgatgttctcattagcgttaatgac
aaaccaattatggatgttcggcaactactgaatcaaattgcacaaattgggccagggaat
acagctgacctgaaagtgttgcgcaagaacaaaactttggatttaaaagtgcaaactgga
aaacgtcccaaacctactgcggttaatcaatga

DBGET integrated database retrieval system