KEGG   Polynucleobacter asymbioticus: Pnuc_0154Help
Entry
Pnuc_0154         CDS       T00502                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00780  Biotin metabolism
pnu01100  Metabolic pathways
Module
pnu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pnuc_0154
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pnu01007]
    Pnuc_0154
Enzymes [BR:pnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Pnuc_0154
Amino acid related enzymes [BR:pnu01007]
 Aminotransferase (transaminase)
  Class II
   Pnuc_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABP33375
UniProt: A4SV61
Position
complement(147261..148496)
Genome map
AA seq 411 aa AA seqDB search
MTGSFNALKLVEDQITDLELQLLKRQLRVTESACDTTALVGNRLLNTFCSNDYLGLANHP
KIIDGLMEGAKKYGVGSGASHLISGHNVAHDHLEKKLASFQASHIPKARALFFSTGYLAN
LAAITGLVRLAPSGGASIYSAKLNHASLIDGVRLASVQNNAAVTLFDHTQPASLLSSIKN
DVRPLKLIVVDGVFSMDGDLAPVKELLRIAEQSDALLLIDDAHGFGVLGKNGHGILEQEN
ISSDRIIYIGTLGKAAGVSGAFVCAKDQFIEWLIQKGRPYIYSTATPPAIAHALLKSLEI
IEGDEGKERRAQLYRLIQIWQDEMSFTQWTKVSSCTPIQPVVLGSNANALMAAKLLDEAS
YWIPAIRPPTVPPGSARLRVTFSASHREEDLYQLIKTLKTIEQQVMDKASS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcgttcaacgccctcaagttagtcgaagatcaaattacagatttggaattg
cagttactcaaacgccaattacgcgtgacagagtcagcctgcgacactacggcattggta
ggtaataggctcttaaatactttctgtagcaatgactatttaggtcttgccaaccatcca
aaaatcattgatggattaatggaaggcgctaaaaaatatggtgttggtagtggcgcatct
catttaattagtggtcataacgttgcgcatgatcacctagaaaaaaaattggcctctttt
caggcaagccatatccccaaggcgcgtgcattattttttagtaccggctatctcgccaat
cttgcagctattaccggtttagtgaggcttgccccttctggtggcgccagtatttattca
gctaaattaaatcacgcctccctcattgatggtgtgcgtttagccagcgtacaaaacaat
gctgcggtgactttgtttgatcacacgcagcccgcatccctactaagctcaatcaaaaat
gatgttaggccgctaaagctcatcgtagtagatggggtatttagcatggatggtgattta
gcacccgtcaaagaactacttcgcattgcagaacaaagcgacgctcttttattgatagat
gatgcccatggttttggtgtactcggtaaaaatggacatggcatattggaacaagaaaac
atcagctctgaccgaatcatttatataggaacacttggcaaggctgctggcgtgagtggt
gctttcgtttgtgcgaaagatcaatttattgagtggctcattcaaaaaggtcgcccctat
atttacagcactgccacacccccagcaatagcgcatgcattattaaaaagcttagaaatt
attgagggcgatgaaggcaaagaacggcgcgcccaactttaccgcctcattcaaatttgg
caagatgaaatgtcgtttactcaatggaccaaagtttcctcctgtacccccattcaacca
gttgttcttggcagtaatgcaaatgccttaatggcagccaagctattggatgaggctagt
tattggataccagccataaggccgcccaccgtacctccaggaagcgcacgcttacgcgtt
accttttccgcaagccatcgggaagaagatttatatcaactcataaagaccttaaaaacc
atcgagcaacaagtcatggataaagcctcttcatga

DBGET integrated database retrieval system