KEGG   Polynucleobacter asymbioticus: Pnuc_0927Help
Entry
Pnuc_0927         CDS       T00502                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00071  Fatty acid degradation
pnu00072  Synthesis and degradation of ketone bodies
pnu00280  Valine, leucine and isoleucine degradation
pnu00310  Lysine degradation
pnu00362  Benzoate degradation
pnu00380  Tryptophan metabolism
pnu00620  Pyruvate metabolism
pnu00630  Glyoxylate and dicarboxylate metabolism
pnu00640  Propanoate metabolism
pnu00650  Butanoate metabolism
pnu00900  Terpenoid backbone biosynthesis
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01120  Microbial metabolism in diverse environments
pnu01130  Biosynthesis of antibiotics
pnu01200  Carbon metabolism
pnu01212  Fatty acid metabolism
pnu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnuc_0927
   00630 Glyoxylate and dicarboxylate metabolism
    Pnuc_0927
   00640 Propanoate metabolism
    Pnuc_0927
   00650 Butanoate metabolism
    Pnuc_0927
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pnuc_0927
   00072 Synthesis and degradation of ketone bodies
    Pnuc_0927
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnuc_0927
   00310 Lysine degradation
    Pnuc_0927
   00380 Tryptophan metabolism
    Pnuc_0927
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnuc_0927
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnuc_0927
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pnuc_0927
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pnu04147]
    Pnuc_0927
Enzymes [BR:pnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pnuc_0927
Exosome [BR:pnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnuc_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABP34143
UniProt: A4SXC9
Position
922362..923546
Genome map
AA seq 394 aa AA seqDB search
MSRDVVVLSAVRSAIGTFNGSLSSFEPSELGGIVMKEAVARSGVDPALINYVTVGNTIPT
DSRYAYVARVASIQAGLPMESVAMALNRLCSSGLQAIVTTAQQIMLGDCDYGIGGGVEVM
SRGMYGSPAMRSGARMGDTKMLDLMVAVLTDPFGVGHMGVTAENLVEKWKLTREEQDALA
VESHRRAANAIKEGRFKSQIVPITIKSRKGDVVFDTDEHCKPETTMETLGKMKAVFKKEG
GSVTAGNASGINDGAAFFVLADAETAKKAGHKPIARLVSYAVAGVPNHIMGEGPIPATKI
ALERAGLKLEQIDVIESNEAFAAQALAVTKGLGLDPAKTNVNGGAIALGHPIGCSGAAIA
TKAIHELHRVQGKYALVTMCIGGGQGIATIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgatgtcgttgtcttaagtgcagttcgttccgcaattggcacctttaatggt
tccctcagtagtttcgagccttcagagcttggtggaatcgtcatgaaagaagcagtcgct
cgctccggtgtggatcctgctttgattaattatgtgactgttggaaatacgattccaaca
gatagtcgttatgcctatgttgcgcgtgttgcatccattcaagctggcttaccaatggaa
tctgtcgcaatggcattgaatcgattgtgcagctctggcttacaagcaattgtgaccaca
gcacaacaaattatgttgggtgactgcgattacggtattggtggcggtgttgaggtgatg
tcacgcggcatgtatggttcaccagcgatgcgcagtggagcgcgtatgggcgataccaag
atgcttgacttgatggtggctgttttgactgatccatttggtgttggtcatatgggtgtt
acagcagagaacctagttgaaaaatggaagcttacacgtgaagagcaagacgccttggcg
gttgaatctcatcgtcgtgctgccaatgcaattaaagaaggtcgtttcaaatctcaaatc
gtccctattacgattaagtcccgcaaaggcgatgtagtttttgatactgatgaacattgc
aagccagaaaccacaatggaaacattgggcaagatgaaggctgtattcaaaaaagaaggt
ggctctgttacagctggcaatgcttcaggaattaacgacggtgctgcattctttgttttg
gccgatgctgaaacagccaagaaagctggtcataagccgattgcacgcttggtgtcttac
gcagttgcaggtgtgccaaaccacatcatgggtgaaggtcctattcctgcgactaagatt
gcgcttgagcgtgctgggttgaaattggagcaaatcgatgtcattgaatccaatgaagct
tttgctgcacaagcattggcggtaacaaaaggcttgggcttagatccagccaagacaaac
gtaaatggtggtgcaattgctttaggtcacccaattggttgttctggcgcagctattgcc
actaaagctatccatgaattacaccgcgtgcaaggtaaatacgctttggtaaccatgtgt
attggtggtggccaaggtattgctactattttcgagcgcctataa

DBGET integrated database retrieval system