KEGG   Polynucleobacter asymbioticus: Pnuc_1404Help
Entry
Pnuc_1404         CDS       T00502                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pnu  Polynucleobacter asymbioticus
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Pnuc_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C
Motif
Other DBs
NCBI-ProteinID: ABP34618
UniProt: A4SYQ4
Position
complement(1475103..1476113)
Genome map
AA seq 336 aa AA seqDB search
MPTIEVAFWVVALLVALALAFDFMNGFHDAANSIATVVSTGVLKPQQAVVFAAFFNFLAI
FIFHLSVAATVGKGIVNPAVVDLHVIFGALVGAIIWNIVTWYYGIPSSSSHALIGGLVGA
ALPKAGLDGLVWSGILKTVSFIFISPFVGFLLGSLMMLLVSWVCRNVTLSKTDRWFRRLQ
LISAGAYSLGHGGNDSQKTIGIIWLLLIITGYTDASASMPPAWTIICCYIAIAMGTMFGG
WRIVKTMGQKLTKLKPVGGFCAETGGAITLFAATALGVPVSTTHTITGAIVGVGSTQRAS
AVRWGVAGNIVWAWIFTIPATALMSMLVYYLSLLIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttgccaacgatagaggtagccttttgggttgtagcgttactggtagcgctagctctcgca
ttcgacttcatgaacggatttcatgatgctgcgaactctattgcaaccgttgtatctacg
ggcgttctaaagccacaacaggcagtcgtattcgctgcctttttcaatttcctggctatc
tttatttttcatttgagtgttgctgctacagtgggtaagggaatcgttaatccagccgtc
gttgatttacatgtcatatttggcgctctggtgggtgcgatcatttggaacatagtgact
tggtattacgggattccctccagctcttcacatgcattaattggcggcttagtgggggcg
gcgcttcctaaagctggcttagatggattggtttggtccggtattttgaaaaccgtttcc
ttcatctttatttcaccttttgtgggcttccttctaggctcattgatgatgctcctcgta
tcttgggtgtgtcgtaacgttaccctgtcgaaaacggatcgttggttccgtcgcttgcaa
ttaatttctgctggcgcatatagtcttgggcatggtggtaatgactcccaaaaaaccatc
ggtattatttggttgctattaatcatcactggttacaccgatgctagtgcaagcatgcct
cccgcgtggaccattatttgctgctacatcgcgattgcaatgggtacgatgtttggcggt
tggcggattgtcaaaacaatgggtcaaaaattaaccaaactcaagccagtgggtggtttt
tgcgcagagacgggtggggcaattactttatttgctgctactgcactgggtgttccagta
tcgactacccatacaatcaccggggctattgttggtgtgggctccacccaaagagccagt
gctgttcgttggggcgtagctggaaacatcgtttgggcttggatcttcacgatcccagcc
accgcattaatgtctatgttggtttactacctcagcttattgattttctaa

DBGET integrated database retrieval system