KEGG   Polynucleobacter asymbioticus: Pnuc_1736Help
Entry
Pnuc_1736         CDS       T00502                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu01040  Biosynthesis of unsaturated fatty acids
pnu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pnuc_1736
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Pnuc_1736
Lipid biosynthesis proteins [BR:pnu01004]
 Desaturase
  First
   Pnuc_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 Phage_P2_GpU
Motif
Other DBs
NCBI-ProteinID: ABP34949
UniProt: A4SZN5
Position
complement(1806292..1807491)
Genome map
AA seq 399 aa AA seqDB search
MNSASVSGFDLFLNWLSNGYLNWAWWQIVVFTLVVTHITIAGVTIFLHRCQAHRALDLHP
IMSHFFRFWLWLTTGMVTKQWAAIHRKHHAKCETVDDPHSPQILGIGTVLSRGAELYKKE
SHNQETLDKFGHGTPDDWVEHNVYSKFSWQGVALMLIIDVFLFGAIGLTVWAVQMLWIPI
TAAGIINGIGHYLGYRNYECEDASTNIFPWGILIGGEELHNNHHTFATSAKLSSKWYEFD
IGWMYIQIMSAVGLAKVKKTSPKPVLSDLRPADQGTLEAIIANRYEIMARYSKTLRSFFN
NEVQHMQVLATHLKDARTWLGKDEAHLTVDEKTKLEELMATNAQLRKMIEMRRDLQAIWG
RSNATGEQLVSQLHSWCQRAEDSGLTSLREFSLRLRRYA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgaactcagcttctgtctcaggttttgatttattccttaactggctatccaacggctac
cttaactgggcttggtggcaaatcgtagtcttcaccttggtggtgacgcacatcacgatt
gctggcgtgactatcttcttgcatcgttgtcaagcacaccgtgccctagatctgcatccg
atcatgtcccactttttccggttttggctctggctgacaaccggcatggttactaaacaa
tgggcagccattcatcgtaagcaccacgccaaatgcgagacggtagatgatccgcatagc
ccacaaattttaggtattggaacagtgttgtctcgtggagctgagctttacaaaaaagaa
tcccacaatcaagaaaccttagacaaatttggtcacggcacaccagatgactgggtcgag
cacaacgtctactctaaattctcatggcagggtgtagcgctgatgctcatcattgatgtg
ttcttgtttggcgcaattggcctaacagtctgggcagtgcaaatgctctggataccaatt
actgctgctggaattattaatggtatcggtcactatctaggctatcgcaattacgaatgt
gaagatgcgtccaccaatatttttccttggggtattttgattggtggtgaagaattgcat
aacaaccatcacacctttgcaaccagtgcgaagctttctagcaagtggtatgagtttgat
attggctggatgtacattcagataatgagtgccgtgggcttggccaaagtgaagaagact
tcacctaagccagtacttagtgacttgcgtcctgcggatcaaggaacactcgaagccatc
atcgcaaaccgttatgaaattatggcgcgctacagcaaaacactgcgcagcttttttaat
aacgaggtacagcacatgcaagtgttggcgacccatctaaaggacgctcgcacttggctt
ggcaaggatgaagcgcatttaactgttgatgagaagacgaagctagaagagttgatggca
acaaatgcacagttacgcaaaatgattgaaatgcgccgtgatctgcaagcgatttggggt
cgttctaatgcgacaggcgagcaacttgtatctcaattacattcctggtgtcagcgtgca
gaagatagcggccttacgagcttacgtgaattctctttaaggttacgccgttacgcttaa

DBGET integrated database retrieval system