KEGG   Polynucleobacter asymbioticus: Pnuc_1879Help
Entry
Pnuc_1879         CDS       T00502                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pnuc_1879
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pnuc_1879
DNA repair and recombination proteins [BR:pnu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pnuc_1879
    RecFOR pathway proteins
     Pnuc_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 IMS_HHH Cdd1 HTH_42
Motif
Other DBs
NCBI-ProteinID: ABP35091
UniProt: A4T027
Position
1954888..1955469
Genome map
AA seq 193 aa AA seqDB search
MIGRIQGTLVSVHPPRLLVDCQGVGYEIDVPMSTLYQLPEVNQKITLLTHFQVREDAQQL
FGFATEIEREAFRQLIKISGVGSRTALAVLSGMSVNELAQAIALQEAGRLTQVPGIGKKT
AERLCLELKGKLAPDLGITGGKPQAIEATSEVLQALLSLGYSEKEALLALKQIPPETSVS
DGIRMGLKYLSKP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcattcaaggtactctcgtttcagttcatcctcctcgtctattggtggat
tgccagggcgttggttatgaaatcgatgtgcccatgagcactttgtatcagctacctgaa
gtaaatcaaaaaattaccctgctcacccactttcaagtacgtgaggatgcgcaacagctt
tttggctttgctaccgagattgagcgtgaagcattcaggcagttaattaaaattagtggg
gtgggctcacgtaccgctcttgcagttctctctggcatgagcgtgaacgaattggctcaa
gcaattgccttgcaagaagctggtcgactcacgcaagtgcctgggattggcaaaaaaact
gctgagcgcctttgcttggagcttaaaggcaaactggcaccagatcttggtattacgggt
ggcaaaccacaagccattgaagcaactagtgaagtattgcaagcgcttttatcattaggt
tactccgaaaaagaagcgcttttagcgctgaagcaaatcccaccagagactagtgtttcc
gatggaattcggatgggtctaaagtatctatctaagccttaa

DBGET integrated database retrieval system