KEGG   Polaribacter sp. ALD11: CW731_11320Help
Entry
CW731_11320       CDS       T05264                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
poa  Polaribacter sp. ALD11
Pathway
poa00361  Chlorocyclohexane and chlorobenzene degradation
poa00625  Chloroalkane and chloroalkene degradation
poa01100  Metabolic pathways
poa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:poa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CW731_11320
   00361 Chlorocyclohexane and chlorobenzene degradation
    CW731_11320
Enzymes [BR:poa01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CW731_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 SpoU_methylase Ribosom_S30AE_C PNK3P Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AUC85841
UniProt: A0A2K8XSB4
Position
2549910..2550617
Genome map
AA seq 235 aa AA seqDB search
MKNNSESIETRRPKVLFFDVNETLLDLTPMKKRVGEVLEGKEEVLSLWFTTMLHYSLVTS
ASGHYKPFGHIGAAALQMVAANNNITISEEKARKIIAESMQNLPPHPEVKEALTQLKKEG
YKLVAFTNSSNEGLKKQFENAELTAYFDERLSVEDTGKFKPFTDTYAWGAHKMGVKLEEC
MLIAAHGWDVAGALWAGWRAAFISRPGQQIFPLAPKTEIVATNLKKVADILVTYK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatagtgaatccatagaaacaagaagacctaaagttttattctttgatgta
aacgaaacgcttttagatcttacaccgatgaaaaaaagagttggtgaggttttagagggg
aaagaagaagtactttctttgtggtttacaacaatgttgcattattctttagtaacttct
gcaagcggacactataaacctttcggacatattggtgctgctgctttgcaaatggttgct
gcaaataataatattacaatatcagaagaaaaagcacgtaagattattgcagaatctatg
caaaacttacctccgcacccagaagtaaaagaagccttaacgcaattaaaaaaagaaggt
tataaattagttgcgtttaccaattcatcaaacgaagggttaaaaaaacaatttgagaat
gcagaattaacagcttattttgatgaaaggctaagcgttgaagatactggtaaatttaaa
ccttttacagatacgtatgcttggggagcacataaaatgggcgttaaattagaagaatgc
atgttaattgcagcacatggttgggatgttgcaggcgcactttgggcaggttggagagct
gcttttataagcagacctgggcaacaaatatttccgttagcaccaaaaacagaaattgtg
gcaacgaacttgaaaaaagtagcggatattctggtaacgtataagtag

DBGET integrated database retrieval system