KEGG   Polaribacter vadi: LPB03_03455Help
Entry
LPB03_03455       CDS       T04504                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pob  Polaribacter vadi
Pathway
pob00030  Pentose phosphate pathway
pob01100  Metabolic pathways
pob01120  Microbial metabolism in diverse environments
pob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LPB03_03455
Enzymes [BR:pob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     LPB03_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C Epimerase
Motif
Other DBs
NCBI-ProteinID: AOW16581
UniProt: A0A1B8TY74
Position
complement(757852..758667)
Genome map
AA seq 271 aa AA seqDB search
MQTSKRLQNQSAIITGSSKGIGKAIAMEFAKEGANVTINYHSSKDEAEETAHLLEEKYKE
IKVLVLKGDVSKETDVKNVFKKSIKEFGTVDICVANAGIQKDYLLHEMPLDAWKKVIDVN
LTGQFLCAKEALNEFLKRGLRKEVSKSIGKIIHISSVHEVIPWAGHANYAASKGGLLMLM
ESICQQYAPLGIRCNSLAPGATKTSINKDVWGNKEGLKKMLKLIPQKRVGEPQDMAQAAV
WLASDESDYVNGTTLFVDGGMTCYPGFSTNG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaagtaaaagattacagaatcaaagtgccataattacaggttctagcaaagga
attggaaaagcaattgctatggaatttgcaaaagaaggcgcaaatgtaactattaactat
catagcagtaaagatgaagcagaagaaactgcgcatttattggaagagaaatataaagaa
ataaaagtattggttttaaaaggagatgttagcaaagaaactgatgtaaaaaacgtattt
aaaaaatcaataaaagaatttggtacagtagatatttgtgtagcaaacgcaggtattcaa
aaagattatttattgcatgaaatgccattagatgcatggaaaaaagtaattgacgtcaat
ttaacaggtcagtttttatgtgcaaaagaagctttaaacgaatttttgaaaagaggttta
agaaaagaggtctcaaaatcaataggtaaaattattcatataagttccgttcatgaagta
attccttgggctggtcatgcaaattatgcagcgtcaaaaggtggtttattaatgttgatg
gaaagcatttgtcagcaatatgcacctttaggaattcgttgcaatagtttggcaccagga
gctacaaaaacgtctatcaacaaagatgtttggggtaataaagaaggtttaaaaaaaatg
ctgaaattaattccacaaaaaagggttggagagccacaagatatggcacaagctgctgtt
tggttggcttcagacgaatctgattacgtaaatggaactactttgtttgtagatggtgga
atgacttgttatcctggtttttctaccaatggataa

DBGET integrated database retrieval system