KEGG   Polaribacter vadi: LPB03_08905Help
Entry
LPB03_08905       CDS       T04504                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pob  Polaribacter vadi
Pathway
pob00360  Phenylalanine metabolism
pob00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pob00790  Folate biosynthesis
pob01100  Metabolic pathways
pob01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LPB03_08905
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPB03_08905
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LPB03_08905
Enzymes [BR:pob01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     LPB03_08905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H ATP-synt_ab_C MIX
Motif
Other DBs
NCBI-ProteinID: AOW19050
UniProt: A0A1B8U402
Position
complement(1998982..2000721)
Genome map
AA seq 579 aa AA seqDB search
MHFELNEVTKKLPKHLHKFVVKQPYEEYTSQNQAVWRYVMRMNVDYLSKVAHKSYIPGLE
KTGISTENIPKMEGMNRILKEIGWAAVSVDGFIPPNAFMEFQAYNVLVIASDMRTINHIE
YTPAPDIIHEAAGHAPIIANPEYSEYLRRFGEIGSKAISSAKDYEMYEAIRLLSILKENP
NSSEKEIIEAQEQVEWLQNNIGELSEMAMIRNLHWWTVEYGLIGTLENPKIYGAGLLSSI
GESAWCMQDEVEKKPYSIDAATINFDITKPQPQLFVTPDFAYLSLVLDEFANTMALRKGG
LNGIKKLIDSKGLGTIELTTGIQISGNFDKVIPFKNNKVAYFQTVGETALANRDKELIGH
GISTHKNGFGSPIGKLKGINLPIEDMSPRDLKAYGIYEGEFMTLEFESGIILKGKAITGT
RDLRGKILMITFDECTVTYKDEVLFQPDWGLYDMAVGKEVVSAYAGAADVASFLDTSKVS
ETKTHKITYSETAKKLYVLYDEVREMRETNSATEDKIEAIFHQLKKEYSEDWLLLLELYE
LALENNFAIKNKLLNTLQALKSNKSYTKLIENGLNLHLN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
ttgcattttgaattgaacgaagtaaccaaaaagttacccaaacatttgcacaagtttgtt
gtaaaacaaccttatgaagaatatacatctcaaaaccaagcagtttggagatatgtgatg
cgaatgaatgtagattatttaagcaaagttgcgcataaatcttacattcctggtttggaa
aaaacaggaatttctactgaaaatattccaaaaatggaaggcatgaaccgaattttaaaa
gaaattggttgggctgcagtttctgtagatggttttattccaccaaatgcttttatggaa
ttccaagcgtataatgtgttggtaattgcatcagatatgcgaactataaatcacatagaa
tatacacctgcaccagatattattcatgaagctgctggacatgcacccattattgcaaac
ccagaatattctgaatatttaagacgctttggagaaattggcagcaaagcaatttcatct
gccaaagattatgaaatgtatgaagctattaggcttttatctattttaaaagaaaatcca
aattctagtgaaaaagaaataatcgaagcccaagagcaagtagaatggttgcaaaataat
attggggaattgtcggaaatggcaatgattagaaatttacattggtggactgtagaatat
ggtttgattggtactttagaaaacccaaaaatttatggagcaggtttgctttcatctatt
ggagaaagtgcttggtgtatgcaagatgaagtggaaaaaaagccatattcaattgatgct
gccactattaattttgatattacaaaaccacaacctcaattatttgtaacgccagatttt
gcatatttaagtttggttttagacgaatttgcaaatacaatggctttgcgaaaaggaggt
ttaaatggcattaaaaagttaatagattctaaaggtttaggaactatcgaattaacgaca
ggaattcagatttctggaaatttcgacaaagtaattccgtttaagaataacaaagttgcc
tattttcaaacagttggagaaactgctttggcaaacagagataaagaattaattggtcat
ggaatttcaacccataaaaatgggtttggaagtccaataggtaagctaaaaggaattaat
ttacctattgaagacatgagtccaagagatttaaaagcttatggaatttacgaaggcgaa
tttatgactttagagtttgagagtggcatcattttaaaaggaaaagcaattactggaact
agagatttacgaggtaaaattttaatgattacgtttgatgaatgtacagtaacttataaa
gacgaagttttatttcaaccagattggggtttatatgatatggctgttggtaaagaagtt
gtttctgcgtatgcaggagctgcagatgttgcttcctttttagataccagtaaagtttct
gaaactaaaacgcataaaataacctattcagaaactgctaaaaaattatatgttttgtat
gatgaagttcgcgaaatgcgtgaaacaaattcagctactgaagataaaatagaagcgata
tttcatcaacttaaaaaagaatattcagaggattggttgttgctcttagagttgtatgaa
ttggctttagaaaacaattttgctatcaaaaataaacttttaaatactttgcaagcatta
aaaagtaacaaaagttacactaaacttattgaaaatggtttaaatttgcatctaaattaa

DBGET integrated database retrieval system