KEGG   Paenibacillus odorifer: PODO_10710Help
Entry
PODO_10710        CDS       T03326                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
pod  Paenibacillus odorifer
Pathway
pod00903  Limonene and pinene degradation
pod00930  Caprolactam degradation
pod01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PODO_10710
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PODO_10710
Enzymes [BR:pod01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     PODO_10710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Thioesterase
Motif
Other DBs
NCBI-ProteinID: AIQ73681
Position
2462051..2462980
Genome map
AA seq 309 aa AA seqDB search
MEKSSTEQLAAIKDYLRQSKRLDSKSIGQIRQEMAATAANMPIPTDVIVERVMIGPVSGE
WIIPVKSAPPADEVILYFHGGGFISGTCEFYRDLVTRIAKASGKKILIIEYRLAPEFTYP
AANEDCIDAYLWLLANGYSAGNVVLGGDSVGASLALMTLITLRDAGVELPAGAFLISPHT
DLVHLDGESYLSRAEFDPTGSIEGNIRIIDVYLGARTELAPILSPLRLDLQGLPDLLVQV
GDHEVLLSDATRLSERAQAADVHVELEIWENMWSVFHFLAYMLPEAQEAIANIGKFVRTR
LDRIEEKSS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtcaagtacagagcagcttgcagcgatcaaagattatctgcgacaaagcaag
cgattggatagcaagtctatcgggcaaatacggcaggagatggccgcgacggctgcgaac
atgcccattcctacggatgttatcgtcgaacgggtcatgattgggcccgtaagtggagag
tggattattcctgtgaaatctgctccacccgctgatgaagtgatcctttatttccatggt
gggggttttatttctgggacttgtgaattttatcgagatttggttacacgaattgcaaaa
gctagtggtaagaaaatcctaatcattgagtatcgcttggcaccagaatttacttatccg
gctgctaacgaagattgtatagacgcttatctgtggctgctcgcgaatggatattctgcc
gggaatgtcgtgcttggaggggattctgttggagccagccttgcgctgatgacgttgatt
actttacgggatgcgggtgtggaattgccggcgggtgcttttttaatctcgccgcataca
gatctcgtccatttggatggtgaatcgtatctgagtcgagcggagtttgatccaacaggc
agcatagaaggaaatatacgaataattgatgtttatctaggtgctcggacagaactagct
cctatattatctcccttaaggttggatttgcagggattacctgatttacttgttcaagta
ggcgaccacgaggtattgttaagcgatgcaacgaggttgtctgaacgagcacaagccgcg
gatgttcatgtagaactggaaatatgggagaacatgtggagcgtctttcactttttagct
tatatgctgccagaggcgcaggaagcgatcgcgaatatcggtaagtttgttagaacgagg
ctagatcgaattgaggaaaaaagcagctga

DBGET integrated database retrieval system