KEGG   Paenibacillus odorifer: PODO_16915Help
Entry
PODO_16915        CDS       T03326                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pod  Paenibacillus odorifer
Pathway
pod00627  Aminobenzoate degradation
pod01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PODO_16915
Enzymes [BR:pod01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     PODO_16915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AIQ74801
Position
complement(3794255..3795043)
Genome map
AA seq 262 aa AA seqDB search
MEQIEGLLIDLDGTLYHGHKMIPGADLLIKALREADIPFLFVTNNSSRTAANVAAHLSGM
GIEAKAEEVCTSSMAAARYIAEESPGATVAILGEEGLRMACIEAGLQIVTESPDYVVQGI
DRSFNYASLAQASRWILSGAKFVLTNPDLMLPSDDGVMPGAGTIGAAIEAASGVKPVVIG
KPESHLIKYATDLLKIQPEHAAVVGDNMRTDIAAGVNAGCRTILVLTGLTTTENLEHYKS
ITGITPDEICADLAELKMFLGV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaattgaaggattattgattgatctagacggtacattgtaccatgggcataaa
atgattcccggtgctgatctgctgataaaggctcttcgtgaagcggatatccctttttta
tttgttaccaataactcatcgcgcacggcagctaacgttgctgcccacttaagtggaatg
ggaattgaggcgaaagctgaggaggtatgtacctcttctatggcagccgcacgttacata
gctgaggaatcacctggggctacagtggcgatacttggagaagagggactgcgtatggct
tgcattgaggcagggctccaaatcgtcacagaatcacctgattatgtggtgcaaggtatc
gatcgttcttttaattatgcttcgttagctcaagcttcgcgttggattttgagcggggca
aagtttgtgctcaccaatccagatttaatgttaccatcagatgatggggttatgccgggt
gcgggtacgatcggtgcagcaattgaggctgccagtggtgtgaagccagtagtgatcggt
aagcctgaatcgcatctgatcaaatatgcgacagatcttctgaaaattcaacctgaacat
gctgctgttgttggggataatatgcgtacggatatcgctgccggtgttaatgcgggctgt
cgtacaatccttgttcttaccggtttaaccactacagagaatctggagcactataaaagt
atcacagggatcactcccgatgaaatatgtgccgatttagctgaacttaaaatgtttctc
ggtgtataa

DBGET integrated database retrieval system