KEGG   Paenibacillus odorifer: PODO_19285Help
Entry
PODO_19285        CDS       T03326                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pod  Paenibacillus odorifer
Pathway
pod00520  Amino sugar and nucleotide sugar metabolism
pod01100  Metabolic pathways
pod01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PODO_19285
Enzymes [BR:pod01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     PODO_19285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIQ75241
UniProt: A0A1R0XA17
Position
complement(4318798..4319946)
Genome map
AA seq 382 aa AA seqDB search
MTYILQNVQVVLQNSIVSAANVWISEGKVMRIDSGDTSIPEGEYERIDGGGHLLVPGMID
VHIHGANGFDMMDGTEESIQEVSKACAASGCTSFLATSVSSTMEDLLEMIRSVKRVIGHE
VGAKIAGIHLEGPYLNPKRKGMQNEKYLRHPNLEEMKLIFQEAGSLIKMVTIAPELPGGM
ELLSFLKERGVVIAIAHSDATYEESKQAFAAGASHVTHCFNGMRPIHHRDPGIVVAAFEE
KHVSLQAIVDNVHLHPAIIRLMHTMKGPEGMVLITDALQAMGLGDGNYIFGGHQVTVSGG
IARLEDGTLASSTVTMNEALRYTVETGISLTDAVQMASTTPANILELQQKGTIITGLDAD
LVLMDDEFKVLWTMVGGQILQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacttatattttgcaaaatgtacaagtagtgcttcagaatagtatagtttcagcggcc
aatgtatggatttctgaaggaaaagtgatgaggatagactcaggagatacctctatccca
gagggtgagtatgaacggattgatggcggagggcatttgttagtgcccggaatgatagat
gtgcatattcatggtgctaacgggtttgatatgatggacggtactgaagagagtattcaa
gaagtatcgaaggcttgcgcagcatctggttgcacctcatttctggctacctctgtgagt
tctacgatggaagatcttttagagatgattcgtagtgtcaaacgtgtaattgggcatgaa
gtgggagcaaagatcgcaggcattcacttagagggaccttatctaaaccccaagagaaaa
ggaatgcaaaatgaaaagtatctgcggcatcctaacttagaggaaatgaagctcattttc
caagaagctggatcactcattaaaatggttacgattgctcctgagctgccgggaggcatg
gagcttctttcctttttgaaggaacggggagtggtgatagcaattgctcattcggatgcc
acatatgaggaatccaaacaagcttttgccgctggggcaagtcatgttacgcattgtttt
aatggcatgcggccgatccatcatcgagatccggggattgtggttgccgctttcgaagag
aaacatgtaagcctgcaagctattgtggataatgtccatctgcatcctgcaattatccga
ttgatgcataccatgaaaggaccagaaggaatggtcttgatcacagatgcgttacaagca
atggggttaggggatgggaactatatatttggaggacatcaggttacggtatctgggggc
atagcgcgattggaagatggcacgctggcctccagtacagttaccatgaatgaagcctta
cgttatactgtcgaaactggaatttcgctgacagatgccgtacaaatggcttcaactaca
cctgctaatattcttgaacttcaacaaaaggggacgataatcactggcttagatgctgac
ctggtcctcatggatgatgaatttaaagtgctctggacaatggtaggagggcaaatctta
cagctgtga

DBGET integrated database retrieval system