KEGG   Pyrobaculum oguniense: Pogu_1406Help
Entry
Pogu_1406         CDS       T01735                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00010  Glycolysis / Gluconeogenesis
pog00620  Pyruvate metabolism
pog00640  Propanoate metabolism
pog00680  Methane metabolism
pog00720  Carbon fixation pathways in prokaryotes
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01120  Microbial metabolism in diverse environments
pog01130  Biosynthesis of antibiotics
pog01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_1406
   00620 Pyruvate metabolism
    Pogu_1406
   00640 Propanoate metabolism
    Pogu_1406
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_1406
   00680 Methane metabolism
    Pogu_1406
Enzymes [BR:pog01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pogu_1406
Lipid biosynthesis proteins [BR:pog01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pogu_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFA39433
UniProt: H6QAF3
Position
1217517..1219523
Genome map
AA seq 668 aa AA seqDB search
MIAKEKEVELPFEEYVINEKWRGKYTPVDAYWKYHAQTVENLEAFWEGVAKELEWFRPWD
KVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDENGYPTDRRKLT
YYDLYREVNKVAYMLKNNFGIKKGDRITLYLPMIPELPVTMLAAWRIGAITSVVFSGFSA
DALAERINDSQSRLVITADGFWRRGKVVRLKEVVDAALEKATGVENVIVFPRLGLKDTPM
TEGRDYWWNKLMQGVPHNAYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYA
TMKWVFDIRDDDIYWCTADIGWVTGHSYVVLGPLLIGATEVMYEGAPDYPQPDRWWSIIE
RYGVTILYTSPTAIRMFMRYGEEWPRKHDLSTLRIIHSVGEPINPEAWRWAYRVLGGERV
AFGSTWWMTETGGIVISHAPGLYLVPMKPGTNGPPLPGFDVDVVDDEGKPAPPGVKGYLV
IKKPWPGMLHGVWGDPERYIKTYWSRFPGMFYAGDYAIKDKDGFIWVLGRADEVIKVAGH
RLGTYELESALVGHKAVAEAAVIGVPDPIKGEVPIAFVVLKQGVQPSDELRKELRAHIRS
TIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEARKAYQE
LKAEIERA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaaagagaaagaagtagagttaccatttgaagagtatgtaataaatgagaag
tggcgtgggaaatatacccccgtcgacgcgtattggaaatatcacgcccagactgtagag
aacttagaggcgttttgggagggggtcgccaaggaactggagtggtttaggccttgggac
aaggtacttgacgcctccaacccgcccttttataagtggtttgtgggggggaggctgaac
ttgtcctacctagcagtagacagacatgtaaagacttggcggaagaacaaacttgccatt
gagtgggagggcgagcctgtggacgagaacgggtacccaacggacaggaggaagttgact
tactacgacctctacagagaggtgaataaagtggcgtacatgcttaagaacaatttcggc
atcaagaagggggatagaattaccctgtacctacccatgatccccgagttgcctgtcaca
atgctggcggcgtggagaattggggcaattaccagcgtggtgttctcaggtttctccgca
gatgccttagccgagcgtatcaacgactcccagtcgcgcttggtcataactgcagacggg
ttctggaggaggggcaaggtggtgagacttaaagaggtggtagacgccgctctggagaaa
gccaccggcgtagagaacgtcattgtatttcccaggctggggctaaaagacacccccatg
acagagggcagggactactggtggaataagctaatgcagggggtgcctcacaacgcatat
atagagccagagcctgtggaaagcgagcacccctccttcatactctacacctccggcacc
acgggcaagccaaagggcattgtccacgacactggcggctgggcggttcacgtatacgcc
actatgaagtgggtatttgacataagggacgacgacatttactggtgcacggcagacatt
gggtgggtcactggacactcctacgtggtgctcggcccattgcttattggcgctaccgag
gtcatgtacgagggcgcgccggattatccgcagccagacaggtggtggtctattatagag
cgctacggcgtgacgattctctacacctcgcccacagccattaggatgtttatgcgctat
ggcgaggagtggccgaggaaacacgacctctccactctaaggataatacactcagtgggc
gaacccataaacccagaggcgtggaggtgggcctatagagtactgggaggggagagagtg
gcctttggctccacttggtggatgaccgagacggggggcattgtaataagccacgcccca
ggcctctacctagtccccatgaagcccggcactaacgggccgccgctcccaggctttgac
gtagacgtagtagacgacgagggaaagccggcgccccccggagtaaagggctacttagta
ataaagaagccatggccaggtatgctccacggagtctggggggatccagagaggtacata
aagacctactggtctaggttcccaggcatgttctacgcaggcgactatgccataaaagac
aaagacggcttcatatgggtactaggcagagccgacgaggtcattaaagtggcaggccac
cgcttgggcacctacgagcttgagtcggcgcttgtcggccacaaggccgtggcagaagcc
gccgtaataggcgtaccagatcccataaagggcgaggtgcccatagccttcgtggtgtta
aaacaaggcgtacagccctcagacgagttgcgaaaagagctgagggcccacatacgttcc
accattggccccattgcagagccggcgcagatattcttcgtcacaaagttgcccaagacg
cgctctggtaagattatgcgccgcctgctaaaggctgtggccaccggcgcgcctttggga
gacgtcaccaccttggaagacgagacgtccgtagaagaggcgagaaaagcctaccaagag
ctaaaagcagagatagagagggcatga

DBGET integrated database retrieval system