KEGG   Pyrobaculum oguniense: Pogu_1911Help
Entry
Pogu_1911         CDS       T01735                                 

Definition
(GenBank) Cellulase M-related protein
Organism
pog  Pyrobaculum oguniense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFA39938
UniProt: H6QB14
Position
1660615..1661529
Genome map
AA seq 304 aa AA seqDB search
MVAAHIDEIGLVVDHIEKEGYLRFRPIGGWNEVILVSQRVWVRTSDGRWIRGVVGSLPPH
VTPSGKEREAPEIKDLFIDIGVSSREEAEKLGVTVGSVAVLDREFAVFNGKVVTGKAFDD
RLGVAVMLYALRMLEKLPVTLYAVATVQEEVRLRGASVAAERINPHYAIALGTTIAADVP
GVWERLHVTKLGKGPAIKVLDGGGGGLFIAHPGLRDHTVKLARELGIPYQMEVLYGGTTD
AMAIAFRREGVPAAVISVPTRYIHYPVEVLDVEDAVNAAKLLKATRKELRRRLWRSFLTR
ELSS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgcacatcgacgagatcggactcgtcgtggaccacatagagaaggagggc
tacctgagattcagaccaattggagggtggaatgaggttattctcgtcagccagcgggtc
tgggtgaggacttcagatggccggtggataagaggggttgtggggtctctgccgccgcat
gtaacgccaagcgggaaggagcgcgaggcgcctgagattaaggacttgtttatagacatc
ggcgtgtctagcagagaggaggcggagaagctaggcgtcaccgtcggatctgtggctgta
ctggatagggaattcgccgtgtttaacggaaaggtggtcaccgggaaggcgtttgacgac
aggttgggagtagccgtgatgctctacgccttgaggatgctggaaaaactacctgtcacc
ctctacgccgtggcgacagtccaggaggaggttagactccgcggggcaagcgtcgctgca
gagcgaattaatccccactacgctattgccctgggcaccaccattgccgccgacgtaccg
ggcgtctgggagaggcttcacgtaacgaagttgggcaagggcccggccataaaggtgctg
gacggcggtgggggtggcctattcatagcccacccaggcctgagggatcacaccgtgaag
ttggcgagggagctcgggatcccctaccagatggaggtgctttacggcggtaccaccgac
gccatggccatagcctttaggagggagggcgtccccgccgctgttatctcggtgcctacg
cggtatatccactacccggtggaggtcctcgacgtggaggacgccgtaaacgcggctaag
ttgcttaaggcaactcggaaagaactacgccggagattgtggagaagtttcttgacaaga
gagttaagtagctag

DBGET integrated database retrieval system