KEGG   Pyrobaculum oguniense: Pogu_1997Help
Entry
Pogu_1997         CDS       T01735                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00760  Nicotinate and nicotinamide metabolism
pog01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pog00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pogu_1997
Enzymes [BR:pog01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Pogu_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like ATP-sulfurylase
Motif
Other DBs
NCBI-ProteinID: AFA40024
UniProt: H6QB27
Position
complement(1735491..1736027)
Genome map
AA seq 178 aa AA seqDB search
MVRGLFPGRFQPPHWGHIYAVKEILKEVDEVIIAMGSAQFNYLLKDPFTAGERIWMLREG
LREGGVDLSRVVIIPIPNVENNLEWLGRVKSYTPPFDVIYTGNPFVALLFREAGYEVRQQ
PMFQRERYSSTRVRELLLRGDPSWEELVPKSVAEIIKKLRGAERVKTAASGEAEPHKW
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtggttagggggctcttcccaggccggttccagcccccccactgggggcatatatatgcc
gtaaaagaaattctaaaagaagtcgacgaggttatcatagcgatgggctcagcgcagttt
aactaccttttgaaagaccccttcactgcaggtgagaggatctggatgctgagggagggg
cttagagaggggggagtcgacctctcccgtgtcgtgataatcccgatacctaatgttgag
aataacctggagtggctggggagagtgaagtcgtacactccgcccttcgacgttatctac
acgggaaacccctttgtcgcccttctgttcagagaggctggctacgaggtgaggcaacag
cccatgttccaaagggagaggtattcctctaccagggtgagggagctcctgcttaggggc
gatccctcctgggaggagttggtgccgaagtccgtggccgagataataaaaaagctcaga
ggcgccgagcgggtcaaaacagcggcgtcgggagaggcggagcctcacaaatggtaa

DBGET integrated database retrieval system