KEGG   Pyrobaculum oguniense: Pogu_2317Help
Entry
Pogu_2317         CDS       T01735                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00340  Histidine metabolism
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Pogu_2317
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pogu_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFA40344
UniProt: H6QBJ3
Position
2009893..2011002
Genome map
AA seq 369 aa AA seqDB search
MRKGFPRDVLEAAGKIIDDVRDGGLGAALKYSERLDGEAPREVLIAPRPGGDPGVVGAAL
EAVRSLEALYRKLAPPSAVDYYGGVLRTVVWKPVRRTALYVPARYVSTLVMLAVPAKAAG
VEELYVVTPPRGVTGEVLAVAKELGIKAVLALGGAHGLAYAAFHLGVDMLAGPGGLYVQA
AKFLLSQYVGIDGIEGPTELVVYAEGVPPETAARGALAQLEHGPTSFAYVLSTDASLLKG
VEEVYKREKTSSMGPLETRLVSSVEEAVEFIDAVAPEHLEVWGRRDIAYRVRNVGAVSVN
MPSPYLDYVAGISHVLPTGGTARWRGIITPLTFMKAVGIAEAVGEIKLAEAARRLAQYEG
FQFHYRALL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagggcttccctcgcgacgtgcttgaggccgccggcaagataattgacgatgtc
agagacggcgggctaggcgccgctcttaaatactccgagaggctcgacggcgaggcgccg
agggaggtcctaatcgcgccgcggcctgggggcgaccccggcgtggtgggggcggcgctg
gaggcggtccgctcccttgaggcgctttacaggaagctggcgccgcccagcgctgtggac
tactacggcggcgtcctcagaacggtggtgtggaagccggtgaggaggacggcgctatac
gtcccggcgcgctatgtctccaccttggtgatgctggccgtgccggcgaaggcggcgggt
gtcgaggagctgtacgtggttactccccccaggggggttacgggggaggtcctcgcagtg
gcgaaggagctggggatcaaggcggttttggcgctgggaggggcccacggccttgcatac
gccgccttccacctcggcgtggacatgctggcgggccctgggggtctctacgtccaggcc
gccaagttcctcctctcccagtacgtggggattgacgggattgaggggccgacggagctt
gtggtatatgcagagggggtgcctcccgagacggcggcgcgcggcgccttagcccagctg
gaacacggcccgacctcctttgcctacgtcctatccaccgacgcctccctcctaaaaggc
gtcgaggaggtgtacaagagggagaagacctcgtctatgggccccctagagacgcggctg
gtgtcaagcgtggaggaggctgtggagttcattgacgctgtggcgccggagcacttggag
gtctggggccggcgggacatcgcgtatagggttaggaacgtgggggcggtgtcggtgaat
atgccctccccctacctcgactacgtggccggcattagccacgtcttgcccacaggcggc
actgcgaggtggcgtggcataatcacgccgctgaccttcatgaaggctgtcggcatcgcc
gaggccgtcggcgaaattaagctggccgaggcggctaggaggctggcgcagtacgagggc
ttccagttccactacagagcgttgttatga

DBGET integrated database retrieval system