KEGG   Pyrobaculum oguniense: Pogu_2517Help
Entry
Pogu_2517         CDS       T01735                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pog  Pyrobaculum oguniense
Brite
Enzymes [BR:pog01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pogu_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_3 GCD14 Methyltransf_24 Methyltransf_25 Ubie_methyltran Methyltransf_11 CMAS SEF14_adhesin Methyltransf_18 Fibrillarin Methyltransf_23 Methyltr_RsmB-F MTS DUF938 Methyltransf_12 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AFA40544
UniProt: H6QBQ1
Position
complement(2184935..2185552)
Genome map
AA seq 205 aa AA seqDB search
MAKKLVDDLEREGVLKSERVKKALLSVPREEFVMPEYRMMAYEDRPLPLFADATISAPHM
VAMMCELIEPRPGMSILEVGTGSGYHAAVCAEAIERRGKVYTVEIVKGLAIYAAQNLERL
GYWGVVEVFHSDGKRGLEKFAPYDAIIVTAAAASIPSALVNQLKDGGIMVIPVEEGFGQV
LYKVVRRGEKTEKKAVTYVLFVPLR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaacttgtcgacgatctggagcgcgaaggtgttctaaaaagcgagcgggtg
aaaaaggcgcttctgtcagttccgagagaggagtttgtcatgcctgaatacaggatgatg
gcatatgaggataggccccttccgctatttgcagacgccactatctcggcccctcacatg
gtggccatgatgtgcgagctaatagagccaagacctggtatgagtatcttggaggtcggg
actgggtccggctaccacgcagctgtatgcgccgaggccatagagaggaggggtaaggta
tatacagtggagattgtgaaggggcttgctatttacgccgcgcagaatctagagagactg
ggatattggggcgttgtggaggtttttcacagcgatggaaagagggggctggagaaattt
gcgccgtacgacgcaattatcgttactgcggcggctgcgtcaataccatctgcgcttgta
aaccagttgaaagacggcggtatcatggtgattcccgttgaggaaggatttgggcaagta
ctttacaaagtggtaaggaggggggagaagacggagaagaaggctgtgacgtatgtgctt
ttcgtaccgttgaggtag

DBGET integrated database retrieval system