KEGG   Pyrobaculum oguniense: Pogu_2623Help
Entry
Pogu_2623         CDS       T01735                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01130  Biosynthesis of antibiotics
pog01230  Biosynthesis of amino acids
Module
pog_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pogu_2623
Enzymes [BR:pog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pogu_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh Ferritin Dus ThiG
Motif
Other DBs
NCBI-ProteinID: AFA40650
UniProt: H6QDG0
Position
2271207..2271956
Genome map
AA seq 249 aa AA seqDB search
MDFLAQVKKAVELRLATEPSPPARSLPLVDFSKALGEFGIIAEYKRASPRGVVRLDMQPW
AYFAMLQPYAAAFSVLTEPFWFLGDYRFIPMAKPFKPVLMKDFVLDKRQIEIAYGYGADA
VLIIYRLVGREKAMELAEYAQRLGLTPVVEVDNLQDAKEAATWGGKIMLGINSRDLATLE
VSFHKAIEIAKALRGDVDFIIESGISKPEEVEKACMLYAKGVLVGTALMKNPALIKELRH
AAESCVSRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcctggcccaggttaaaaaggccgtggagctccgcctcgccaccgagccgagt
ccccccgcgaggtcgctgccccttgtcgatttctcgaaggcactgggggaatttggaata
attgccgagtataagagagcgtctccgcggggggttgtgcgtcttgacatgcagccgtgg
gcctacttcgccatgcttcagccctatgcggccgcgttttcggtacttacagagcccttc
tggtttctcggcgactaccgattcatccccatggccaagcccttcaagccggtactcatg
aaagacttcgttttggacaaaagacaaattgaaattgcatatggatacggcgcagacgcc
gtcctcataatctatcgcctagtgggaagggagaaggccatggaactcgcggagtacgcc
cagcggcttggcttgacgccggtggtggaggtagacaacctccaagacgccaaggaagcc
gccacgtggggaggcaagatcatgttgggcataaattccagggacttagccacgctggag
gtgagcttccataaggcgattgagatcgctaaggcgttgcggggtgacgtcgactttata
atagagagcggtatatcaaagccagaggaggtggaaaaagcatgtatgctatacgccaag
ggagtcctcgtcgggacagccctaatgaaaaaccccgcattaataaaggagcttaggcac
gccgccgagtcgtgtgtctcgcggcggtga

DBGET integrated database retrieval system