KEGG   Polynucleobacter paneuropaeus: DPM16_00325Help
Entry
DPM16_00325       CDS       T05507                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
poh  Polynucleobacter paneuropaeus
Pathway
poh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:poh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DPM16_00325
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:poh03011]
    DPM16_00325
Ribosome [BR:poh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DPM16_00325
  Bacteria
    DPM16_00325
  Archaea
    DPM16_00325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: AWW43801
UniProt: A0A2Z4JL74
Position
59708..60037
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPIARAMNILNFSPKKAAFIVKKVVESALANAEH
NKGADIDELKVSAVIVDKGTSLKRFTARAKGRGNQIEKQTCHISVTLSK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaaagcaattcaccgcggcgcccgcatttctgcgcaaaagacacgactggtc
gctgaccagattcgtggtttgccaattgcgcgcgctatgaacattttgaatttcagcccc
aaaaaagctgctttcattgtgaaaaaagttgttgagtctgcactcgctaacgctgagcac
aacaaaggcgccgatattgatgaactcaaagtatcagcagtcattgttgacaagggaaca
tccttgaagcgctttactgctcgtgctaagggtcgtggcaatcaaatcgaaaaacaaaca
tgtcacattagcgtgaccctgagtaagtaa

DBGET integrated database retrieval system