KEGG   Polynucleobacter paneuropaeus: DPM16_06770Help
Entry
DPM16_06770       CDS       T05507                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
poh  Polynucleobacter paneuropaeus
Brite
KEGG Orthology (KO) [BR:poh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DPM16_06770
Enzymes [BR:poh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DPM16_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AWW44947
UniProt: A0A2Z4JUK8
Position
1339895..1340716
Genome map
AA seq 273 aa AA seqDB search
MNSSEIQIAAIQMVSTPVPEENLETASRLIKAAAEAGAQIAVLPEYFCLMGLKDTDKLQT
SEELGKGPIQEALRSIAKANSIYLVAGTIPLQASIDNKVLNTTLVFNPAGEQIGRYDKIH
LFGFETETERYAEAETIESGNQPGILDLNINGINWRFGLSICYDLRFPELYRSIGPVDCH
IIPAAFTYTTGKDHWEILLRARAIENQCYVLASAQGGQHQNSRRTWGNSMLIDPWGTVLT
YLPEGEGFISGILSKDKLNEVRSKLPALKHRKL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatccgaaatccagattgcagcaattcagatggtatcaacaccggtacccgaa
gaaaatttagagactgcaagtcgactcattaaagccgctgcagaagcaggcgcccagata
gcagtgctacccgagtatttttgcctaatgggtctaaaagataccgataagctacagacc
agtgaagagctgggtaaaggacctattcaagaagctctgcgttcgattgctaaagcgaat
tcaatttatctagtcgcaggaacgattccacttcaagccagtattgacaataaagtttta
aacacgactcttgtatttaatccagccggagagcaaattgggcgttacgacaaaatccat
ttatttggattcgagactgagacagaaagatatgccgaagcagaaacgatcgaatctgga
aaccagccaggcattctcgatttgaacatcaatgggataaattggcgttttggactgagc
atttgctatgacctccgttttcctgagttatatcgctcgataggtccagttgactgccat
attattcccgcggctttcacttacaccacaggaaaagaccattgggaaatcttattacgg
gcacgtgcaattgaaaaccaatgctatgttcttgcctcagcccaaggcggtcaacaccaa
aatagtcggcgcacttgggggaacagcatgttaattgatccctgggggactgttctaacc
tacctccctgagggggaaggctttatttctgggatactcagcaaagataagctaaacgag
gtacgctccaagttacccgccctgaaacaccgcaagctttaa

DBGET integrated database retrieval system