KEGG   Polynucleobacter paneuropaeus: DPM16_07050Help
Entry
DPM16_07050       CDS       T05507                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
poh  Polynucleobacter paneuropaeus
Pathway
poh00230  Purine metabolism
poh01100  Metabolic pathways
poh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:poh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DPM16_07050 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:poh01002]
    DPM16_07050 (ggt)
Enzymes [BR:poh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     DPM16_07050 (ggt)
Peptidases and inhibitors [BR:poh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   DPM16_07050 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AWW44996
Position
1399044..1400642
Genome map
AA seq 532 aa AA seqDB search
MQQKWGIQGMAVAPHSLASESAVAVLREGGNALEAMIAAAATIAVVYPHMNSIGGDSFWV
IHSPGKAMGGIDACGAAAGLASKKWYAERGITKSIPFRGAVAANTVAGTISGWGAAQQLS
QQALRGKIPLSRLLADAIHYAEAGVPVTFSQSSLTAKKREELSPIPGFAETFLVNGRAPA
VGSIFKQERLAKTLRQIARKGTEDYYRGDLAELLAKELAELGSPLRLNDLHRHQAKLIDP
LELKHSLGHVYNMTPPTQGVVSLMILGILDQLNLKRFKVDSAEYVHHCVEATKQAFKVRD
QFVTDPAYMKKHAQSFLAPAFLKKLAKNIDSEKALPWGQGKGPADTIWMGVVDKQGNSVS
FIQSIYHEFGAGIVLPSSGVNWQNRGCSFSLDPKTLNHLEPYRKPFHTLNPALALFKDGK
TMVYGTMGGDGQPQTQCAVFTRTATYGLDPQDAISRPRWLLGRTWGQTSDSLKLESRFSP
WVAKELHAMGHEIEMLDAFDETVGHAGCIIREASGTLRGGWDPRSDGAVSAF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaaaatggggtattcaggggatggcggttgcaccgcattccctagcatcagaa
tcagcagtggctgttctgcgagaaggtggtaacgcactggaggcaatgattgctgctgct
gcaaccattgccgtggtctacccccatatgaactcgattggcggtgactctttttgggtc
attcactctcccggcaaagcgatgggcggcattgatgcttgcggcgctgctgcaggctta
gctagtaaaaaatggtacgcagaacgaggcatcactaagtcaatccctttcaggggtgca
gtagctgcaaataccgttgcaggaacgatttcaggctggggggctgcacaacaactttct
cagcaagcgttgagaggcaagatcccactctcacgattattagcagacgcaattcattat
gcagaagctggcgtgccagtgactttcagtcaatccagtctgactgccaagaaacgggaa
gagctgagtcccattcctggttttgcagaaacttttctcgttaatggccgcgcccctgca
gtcggtagcatctttaaacaagagcgtttggcaaaaaccttgcgacaaattgctagaaag
ggaacggaagattattaccgcggtgatctggctgaattactcgcgaaagaacttgcggaa
ttaggaagcccactgcgtctaaatgatttgcatcgtcaccaagctaagctcattgatcct
ctagaactaaaacatagcttgggtcatgtttacaacatgactcccccaacccaaggtgta
gtctctttaatgattttgggtatcttggatcaactgaacctgaagcgcttcaaagtcgat
agcgctgaatatgtacaccactgtgttgaagccactaagcaagcctttaaagtgcgcgat
caatttgtcactgatcctgcgtatatgaaaaaacatgcgcaatcttttttagctcctgct
tttctaaagaagctagcgaaaaatattgactctgaaaaagctttaccttggggtcaaggt
aaaggtcctgccgataccatttggatgggtgttgttgataaacagggtaatagcgtttcc
ttcattcaaagtatttatcacgagttcggtgccggcattgtgttgccaagttcaggcgtc
aattggcaaaaccgtggttgcagtttttctctagaccccaaaacactcaatcatcttgag
ccctatcgcaagccattccatacactgaatccagcattagctttatttaaagatggcaag
acgatggtgtacggaacgatgggcggcgatggacaacctcaaacacaatgtgcagtcttt
actcgcactgcgacatacggtcttgacccacaagatgctatcagccgtcctcgctggtta
ctggggaggacctgggggcaaaccagcgatagcctcaaactcgaatcccgctttagtcca
tgggtcgcaaaagaacttcacgcaatgggtcatgaaattgagatgctcgatgcctttgat
gaaaccgtaggacatgccggatgcatcatccgtgaagcctctggcactctcagaggcggc
tgggatccccgcagcgatggagcagttagcgcgttttag

DBGET integrated database retrieval system