KEGG   Polynucleobacter paneuropaeus: DPM16_07570Help
Entry
DPM16_07570       CDS       T05507                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
poh  Polynucleobacter paneuropaeus
Pathway
poh00270  Cysteine and methionine metabolism
poh00480  Glutathione metabolism
poh01100  Metabolic pathways
Module
poh_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:poh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DPM16_07570
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DPM16_07570
Enzymes [BR:poh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     DPM16_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AWW45089
Position
complement(1498070..1499011)
Genome map
AA seq 313 aa AA seqDB search
MDFLFIADPLESFKVSKDSTLAMMRAAQSAGHHLWFAQSRNILWRDENVVADCQALAIKP
SGNSWFDLGKTESRTLKDFSAVLMRTDPPFDIEYLNTTWLLSAAVRQGAKVFNDPSAIRD
HSEKLSITEFPDLIPPTLVTRELSAVMEFHKEHRDIVIKPLDGMGGMGVFRVGPDGLNLA
SIVETLGEGGSRTLMIQRFLPEIVQGDKRVLLIGGEVVPFALARIPQGSEIRGNLAAGGM
GVAMPLSTQELGIAQKLALLLNQRGLFLVGLDLIGGFLTEINVTSPTCFVEITEQSGFHV
AQFWLDALEKALK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggattttttatttattgcagatccacttgagagttttaaggtctcgaaagactcgact
ctagctatgatgcgcgctgctcaatctgcgggacatcatttatggtttgcacaaagccgc
aatattctttggagagatgaaaatgtagttgctgattgccaagcattagcaattaaaccc
agtggaaattcttggtttgacttaggaaaaacagagtcacgcaccctaaaggatttttct
gcagtgctaatgcgcaccgatcctccatttgatattgagtaccttaataccacttggctc
ttgtctgccgctgtgcgtcaaggtgcgaaggtattcaatgatccaagcgccattcgggat
cattcagaaaagctatccattactgaatttcctgatttgatcccccctactttagtgact
cgtgaactctcagcggtaatggagtttcataaagaacatcgcgatatcgtgattaaaccc
ttggatggtatgggtggtatgggcgtatttcgcgtcggacccgatggcctaaacttagca
agtattgttgagactctgggagagggcggctccagaaccttgatgattcagcgtttcctg
ccagagattgttcagggtgataagcgggtccttttaattggtggtgaggtcgtgcctttt
gcattggctcgtattccgcaaggtagcgagattcggggcaacttggctgctgggggcatg
ggagttgcaatgccactgagcactcaagaattggggattgcacaaaaattggctctatta
cttaatcaacgcggtttatttttagtaggattagatttaatcggtggatttttgacggaa
attaatgtcacaagcccgacttgttttgttgaaataactgagcaaagcggttttcatgta
gctcagttttggctagacgctttagagaaagcattgaaataa

DBGET integrated database retrieval system