KEGG   Pseudomonas orientalis: BOP93_09160Help
Entry
BOP93_09160       CDS       T05323                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
poi  Pseudomonas orientalis
Pathway
poi00051  Fructose and mannose metabolism
poi00520  Amino sugar and nucleotide sugar metabolism
poi01100  Metabolic pathways
poi01110  Biosynthesis of secondary metabolites
poi01130  Biosynthesis of antibiotics
poi02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:poi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BOP93_09160
   00520 Amino sugar and nucleotide sugar metabolism
    BOP93_09160
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    BOP93_09160
Enzymes [BR:poi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BOP93_09160
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BOP93_09160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase NTP_transf_3 Cupin_2 AraC_binding DUF3153
Motif
Other DBs
NCBI-ProteinID: AUZ45750
UniProt: A0A2L0RUQ1
Position
complement(2073275..2074735)
Genome map
AA seq 486 aa AA seqDB search
MNTLNGLIPCIISGGSGTRLWPVSRQNMPKPFMRMRDGQSLLQKTFQRAARLPGVESVLT
VTNRDLLFRTLDDYRSVNKVHLPLDLLLEPFGRNTAAAIAVAALHVQEHFGGEAQLLVMP
ADHLVLDESAFAEAVTQARELAEAGYLVTFGIQPDHPETGFGYIEKGEALSLGNRVKRFV
EKPDLATAQAYLDGGKHLWNAGMFCFKASTLVDELNTHAPDVLIAARAALEHSQHLQNKT
SRQRELDSDAFASAPDISIDVALMEKSQQVAVVPCDIGWSDIGSWEALRQLTPSDAQGNQ
VNGEAILHDVRNCYIDSPKRVLGAVGVRDLIIVDTPDALLIADANRSQDVRYIVAELKRQ
NHPAFSLHRTVTRPWGTYTVLEESSRFKIKRIVVKPQASLSLQMHHHRSEHWVVVSGAAQ
ITNGEREFLINANESTYIPAGHKHRLTNPGIIDLVMIEVQSGEYLGEDDIVRFDDIYGRA
PAEVKK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctcaacggattgattccctgcattatttccggtggttcgggcacacgcttg
tggccggtgtcccggcagaacatgcccaagccgttcatgcgcatgcgcgacggccagagc
ctgctgcagaaaaccttccagcgcgccgcacgcctgccgggtgtggaaagcgtgctgacg
gtgaccaaccgcgacctgctgtttcgcaccctggacgactaccgcagcgtcaacaaggtc
cacctgcccctggacctgctgctcgaaccgttcgggcgcaataccgctgcggccatcgcc
gtggcggcgctgcatgtgcaggaacatttcggtggcgaggcgcaactgctggtgatgccc
gccgaccacttggtgctcgatgaaagcgccttcgccgaggcagtgacccaggctcgcgaa
ctggccgaagccggctacctggtgaccttcggcatccagcccgaccacccggaaaccggc
ttcggctatatcgaaaaaggcgaagcgctgagcctgggcaaccgggtcaagcgctttgtc
gaaaagcccgacctggccaccgcccaagcctacctcgacggcggcaaacacctgtggaac
gccggcatgttctgcttcaaggccagcactctggtggatgaactgaacacccatgccccc
gacgttctgattgctgcgcgtgccgccctcgaacacagccagcacctgcaaaacaaaacc
tcgcgccagcgcgaactggacagcgacgccttcgccagcgcgccggacatctccattgac
gtggcgctgatggaaaagtcccagcaagtggccgtggtgccgtgcgacatcggctggagc
gatatcggttcctgggaagccctgcgccagctcacccccagcgatgcccagggcaaccag
gtcaatggcgaagcgatcctgcacgacgtgcgaaactgctacatcgactcgcccaagcgc
gtactcggtgcggtcggcgtgcgtgacctgatcatcgtcgacacccccgacgccctgctg
atcgccgacgccaaccgcagccaggacgtgcgctacatcgtggccgaactcaagcgccag
aatcatccggccttcagcctgcaccgcaccgtgacccggccgtggggcacctacaccgtg
ctggaggaaagcagccgcttcaagatcaagcgcatcgtggtcaaaccccaggcgtcgctg
tcgctgcaaatgcaccaccaccgcagcgagcactgggtggtggtcagcggcgcggcgcag
atcaccaatggcgaacgtgaattcctgatcaacgccaacgaatccacttatataccggcc
ggacacaaacaccgcctgaccaaccccggcatcatcgatctggtgatgatcgaagtgcag
agcggcgaatacctgggcgaagacgatatcgtgcgcttcgatgacatctacgggcgtgcg
cctgccgaagtgaagaagtga

DBGET integrated database retrieval system