KEGG   Pseudomonas orientalis: BOP93_16445Help
Entry
BOP93_16445       CDS       T05323                                 

Definition
(GenBank) 4-amino-4-deoxy-L-arabinose lipid A transferase
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
poi  Pseudomonas orientalis
Pathway
poi00540  Lipopolysaccharide biosynthesis
poi01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:poi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BOP93_16445
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BOP93_16445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:poi01003]
    BOP93_16445
   01005 Lipopolysaccharide biosynthesis proteins [BR:poi01005]
    BOP93_16445
Enzymes [BR:poi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     BOP93_16445
Glycosyltransferases [BR:poi01003]
 Polysaccharide
  Bacterial polysaccharide
   BOP93_16445
Lipopolysaccharide biosynthesis proteins [BR:poi01005]
 Lipid A
  BOP93_16445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-ProteinID: AUZ47119
UniProt: A0A2L0RYI7
Position
3792332..3793987
Genome map
AA seq 551 aa AA seqDB search
MTRLKPLPVLVLGLVIFLVLPLGLHGLWTPDETRYAQVSQEMLISGNWVAPHFMGVRYFE
KPAAGYWLIALGQAVFGENLFGVRIASVLTSALSVLLAYLMARRLWNDPRKSFACALLYM
SFGLVAGQAGYSNLDPQFTFWVNLSLVALWFALAGTTPRARLGAWAVLGLACGVGFMTKG
FLAWLLPVLIALPYMIWQRRVGELLRYGPLAILVAVLVCLPWALAIHGREPDYWRFFFWH
EHIRRFASDTAQHVRPGWFFLPIMVVACLPWSGLLPATLLNAWKHRREPAIAFLALWLLL
PLGFFSLSSGKLPTYIMPCLLPLALLMGHALIDLLNQRKTRAIFINGTLNFILGMTAMVA
LIYLQIANPIYSNSHAEMFNLSLAFIVLLGWILANLLQAMRPLTLWAMPALGIGLLVALL
PASMPQIIADNEMPDQFVLEHLDELQHTHALLSNELGSASALAWRLRRPQVAFYNTAGEL
RYGLDYPESQPRKVTLDNVQTWLSEARTQGSVGVLMRVKSTSEHLEEGQLPPGGKRYRKG
NLVLTIYPQQP
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacccgattgaagcccttgccggtgctggtgcttggcctggtgattttcctggtgctg
ccgttgggtttgcacggtttgtggaccccggatgaaacccgctacgcccaggtcagccag
gaaatgctgatcagcggcaactgggtagcaccgcacttcatgggggtgcgttatttcgag
aaaccggccgcgggttattggctgatcgccctgggccaggccgtgtttggcgagaacctg
ttcggcgtacgtatcgcctctgtcctgacctcggcgttgagcgtgctgctggcctacctg
atggcccgccgcctgtggaacgacccgcgcaaaagttttgcctgcgcgttgctctacatg
agttttggcctggtggccgggcaagccgggtattccaacctcgatccgcaattcacgttc
tgggtcaacctgagcctggtcgccctctggtttgcgctcgccggcaccacgccgcgcgcg
cgcctgggggcctgggccgtactgggactggcctgcggcgtgggcttcatgaccaagggc
tttctggcgtggctgttgccggtgctgatcgccctgccttatatgatctggcagcgccgc
gtcggcgagttgctgcgctacggcccgttggcgatcctggtcgcggtgctggtctgcctg
ccgtgggcgctggcgatccatgggcgcgaaccggattactggcgtttcttcttctggcat
gaacacatccgccgcttcgcctcggacactgcacagcatgtgcggccagggtggtttttc
ctgccgatcatggtggtggcgtgcctgccctggtccggtctgctgcccgccaccctgctc
aacgcctggaaacacaggcgcgagccggccatagcctttctggccctgtggctgttgctg
cccctgggcttcttcagcctgagcagcggcaagctgcccacctacatcatgccgtgcctg
ttacccctggcgttgctgatgggccatgccttgatcgacctgctcaaccagcgcaaaacc
cgtgcgatcttcatcaacggcacgctcaatttcatcctcggcatgacggccatggtggcg
ctgatttacctgcagatcgccaacccgatctacagcaacagccacgccgaaatgttcaac
ctgtccctggcctttatcgtgctgctcggctggatcctggccaacctgctgcaagcgatg
cgcccgttgacgttatgggcgatgccggccctgggtatcggcctgctggtggcgctgctg
ccggcgagcatgccgcagatcatcgcggacaacgaaatgcccgaccagttcgtgcttgag
catctggatgaactgcaacacacccatgctttgctgagcaacgaactaggctcggcgtcg
gccctggcgtggcgcctgcgccggccgcaggtagccttctacaacacggcgggcgagctg
cgctacggcctggattacccggagtcgcaaccgcgcaaggtcaccctggacaacgttcag
acctggttgagcgaggcacgcacacagggttcggtcggcgtgctgatgcgcgtcaagagc
accagcgagcaccttgaggagggtcaactgccgcccggtggcaagcgctaccgcaagggc
aacctggtattgacgatttacccccaacaaccttga

DBGET integrated database retrieval system