KEGG   Pseudomonas orientalis: BOP93_18345Help
Entry
BOP93_18345       CDS       T05323                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
poi  Pseudomonas orientalis
Pathway
poi00360  Phenylalanine metabolism
poi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
poi00790  Folate biosynthesis
poi01100  Metabolic pathways
poi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:poi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BOP93_18345
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BOP93_18345
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BOP93_18345
Enzymes [BR:poi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BOP93_18345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AUZ47470
UniProt: A0A2L0RZM4
Position
4232708..4233499
Genome map
AA seq 263 aa AA seqDB search
MKQTHYVAREPDAQGFIHYPPEEHAVWKTLITRQLKVIEGRACQEYLDGIDKLGLPLDRI
PQLGEINTVLADTTGWQVARVPALIPFQTFFELLASKQFPVATFIRTREELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLAATKEQRVYLARLYWMTIEFGLVNTPEGLRIYG
GGILSSPKESVYCLSDEPERQAFDPLEAMRTPYRIDILQPLYFVLPELKRLFDVAQEDIM
GMVERGKQLGLHAPKFPPKPKAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgcactacgtggcccgcgagcccgatgcgcaaggttttatccactacccg
ccagaagaacatgcggtgtggaagaccctgatcacgcgccagttgaaggtgatcgagggc
cgtgcctgccaggaatacctggatggcatcgacaagctcggcctgcccctggatcgcatc
ccgcagctgggcgagatcaacacagtgctggccgatactaccggctggcaagtcgcccgc
gtgccggcgctgatccccttccagaccttcttcgagttgctcgccagcaagcagtttccg
gtggcaacctttattcgtacccgcgaagaactggactacctgcaagagccggatattttc
cacgagatcttcggccactgcccgctgctgaccaacccctggtttgccgaattcacccac
acctacggcaagctcggcctggcggccaccaaggagcaacgggtgtacctggcgcgcctg
tactggatgaccatcgagttcggcctggtgaacacacccgaaggcctgcgcatctacggt
ggcggcattctgtcttcgcccaaggaaagtgtgtattgcctgtcggatgagcctgaacgc
caggcgttcgatccgctggaggcgatgcgcacgccctatcgcatcgacatcctgcagccg
ttgtacttcgttttgcccgagctcaagcgcctgttcgacgtggcgcaggaagacatcatg
ggcatggtcgagcgtggtaagcagttgggcctgcacgcaccgaaatttccgccaaagccc
aaggctgcttga

DBGET integrated database retrieval system