KEGG   Pseudomonas orientalis: BOP93_24015Help
Entry
BOP93_24015       CDS       T05323                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
poi  Pseudomonas orientalis
Pathway
poi00625  Chloroalkane and chloroalkene degradation
poi00680  Methane metabolism
poi01100  Metabolic pathways
poi01120  Microbial metabolism in diverse environments
poi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:poi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BOP93_24015
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BOP93_24015
Enzymes [BR:poi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BOP93_24015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AUZ48527
UniProt: A0A2L0S2G7
Position
complement(5472513..5473712)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGNGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEMHTGVCLSVNPARP
GGAYGYVDMGDWTGGQAEYALVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNPIRLAHAKAQGFEIADLSTD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHDGVKAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgtggtgtcgtgtatctcggcaacggcaaggtcgaagtacagaaaatc
gactatcccaaaatgcaggacccgcgcggcaggaagatcgagcatggcgtcatcctgcgc
gtggtttccaccaacatctgcggctccgaccaacacatggtgcgcggccgcaccactgcc
cagaccggcctggtgctggggcatgaaatcactggcgaagtgatcgagaagggcagcgac
gtcgagaacctgaaaatcggcgatctggtgtcggtgcctttcaacgtggcctgcggccgt
tgccgctcctgcaaggaaatgcacactggcgtgtgcctgagtgtcaatccggcgcgcccg
ggcggtgcttacggctacgttgacatgggcgactggaccggcggccaggccgaatatgcg
ctggtgccttacgccgacttcaacctgttgaaactgccggaccgcgacaaggccatggag
aaaatccgtgacctgacctgcctctccgacattctgcccaccggctaccacggcgccgtc
acggccggcgttggcccaggcagcacggtctacatcgccggtgccggcccggtcggcctg
gccgctgccgcgtcagcacgtctattgggcgctgcggtggtgattatcggcgacgtcaac
ccgatccgcctggcccacgccaaggcccagggtttcgagatcgccgacctgtccaccgac
acgccattgcacgaacagatcgccgcgctgctcggcgagccggaagtggactgcgccgtc
gatgccgtcggctttgaagcccgcggccacggtcacgacggcgtcaaggccgaggccccg
gccaccgtgctcaactcgctgatgggcgtggtgcgtgtggcgggcaagatcggtattccg
ggcctgtacgtcactgaagatccaggcgctgtcgatgccgccgcgaaaatgggcagcctg
agcattcgctttggtttgggctgggccaaatcccacagcttccacaccgggcagacgcca
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccggatcaacatcgct
gagatcgtcggcgtgcaggtgatcagcctggatgacgcgccgcgcgggtatggcgagttc
gatgcgggtgtgccgaagaagtttgtgattgatccgcataagttgttcagtgcggcgtaa

DBGET integrated database retrieval system