KEGG   Polaromonas sp. JS666: Bpro_0886Help
Entry
Bpro_0886         CDS       T00343                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00010  Glycolysis / Gluconeogenesis
pol00260  Glycine, serine and threonine metabolism
pol00680  Methane metabolism
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
pol01230  Biosynthesis of amino acids
Module
pol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pol_M00002  Glycolysis, core module involving three-carbon compounds
pol_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_0886
  Energy metabolism
   00680 Methane metabolism
    Bpro_0886
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpro_0886
Enzymes [BR:pol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bpro_0886
Membrane trafficking [BR:pol04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bpro_0886
Exosome [BR:pol04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bpro_0886
  Exosomal proteins of melanoma cells
   Bpro_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ABE42842
UniProt: Q12F50
Position
complement(907697..908578)
Genome map
AA seq 293 aa AA seqDB search
MFFTKPVILEWRPEIAYRLPLLPLPAAPFLTPVFTSSLSFPPDCHTMYKLVLIRHGESTW
NLENRFTGWTDVDLTETGIQQAKDAGKLLKAEGYDFDLAYTSVLKRATRTLWHVLDEMDR
TWLPVVNSWRLNERHYGALQGLNKAETAKKYGEDQVLIWRRSYDTPPPPLAANDERCERG
DPRYAKLPPEQVPLTECLKDTVARVLPFWNESMAPAIKAGKRVVVAAHGNSIRALVKYLD
NISDSDIVGLNIPNGIPLVYELDAQLRPLRHYYLGDSEAAARAVAAVSAQGKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgtttttcaccaaaccagtgattttagaatggaggccggaaattgcctaccggctgcct
cttttacccctgcctgctgcaccctttctcacccccgttttcacttcatccctctccttc
ccacccgactgccacaccatgtacaaactcgtactcatccgccatggcgaatccacctgg
aaccttgaaaaccgatttaccggctggaccgatgtcgacctgacggaaaccggcatccag
caagccaaggatgccggaaagctgctcaaggccgagggttacgactttgacctggcctac
accagcgtgctcaagcgcgccacccgcaccctctggcatgtgctggacgagatggaccgg
acctggctgccggtcgtgaacagctggcggctgaacgagcgccattacggcgcgctgcag
ggcctgaacaaggccgagacagccaaaaaatatggcgaagaccaggtactgatctggcgc
cgcagctatgacacgccgcccccgccgctggcggccaacgacgagcgctgcgaacgcggc
gacccccgctatgccaagctgccgcccgagcaggtgccgctgacggagtgcctgaaagac
acggtggcgcgggtgttgcccttctggaatgagtccatggcacccgccatcaaggccggc
aagcgcgtggtggtggctgcccacggcaactcgatacgcgcgctggtgaagtacctggac
aacatctccgacagcgacatcgtgggactcaacatccccaacggcattccgctggtgtat
gagctggatgcccagctcaggcccctgcgccactactacctgggcgacagcgaagccgct
gccagggccgtggcggccgtcagcgcccagggcaaggcctga

DBGET integrated database retrieval system