KEGG   Polaromonas sp. JS666: Bpro_0895Help
Entry
Bpro_0895         CDS       T00343                                 

Definition
(GenBank) pantothenate synthetase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00410  beta-Alanine metabolism
pol00770  Pantothenate and CoA biosynthesis
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
Module
pol_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpro_0895
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Bpro_0895
Enzymes [BR:pol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     Bpro_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase TraE
Motif
Other DBs
NCBI-ProteinID: ABE42851
UniProt: Q12F41
Position
complement(913113..913961)
Genome map
AA seq 282 aa AA seqDB search
MHIVHSIAELREKLAPFQRPAFVPTMGNLHDGHIALVKQAKPLGDVTVSSIFVNRLQFAP
HEDFDSYPRTLDADAQRLEAAGCNVLFAPREKELYPEPQTYKIHPATDLGDILEGHFRPG
FFIGVSTVVLKLFSCVYAGKPSGVAAFGKKDYQQVLVVRRMVQQFALPIEILAGETQRAA
DGLALSSRNSYLSPNERIEAAQLSKALKALGDAARATPTPDLLALEAQAMQALARRGWKP
DYLTVRRRADLQPPQGPLASEPLVVLGAAKLGNTRLIDNLEI
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgttcacagcatcgccgaactgcgcgaaaaactggcacccttccagcgcccg
gcctttgtgcccaccatgggcaacctgcatgacggccacatcgcgctggtcaagcaggcc
aagccgctgggcgacgtgacggtgtccagcatttttgtgaatcgcctgcagtttgcgccg
catgaggatttcgacagctacccgcgcacgctggacgccgatgcccagcgcctggaagcc
gcaggctgcaatgtgctgtttgcgccgcgcgagaaagagctgtaccccgagccgcagacc
tacaagatacaccccgccaccgacctgggcgacatcctcgagggacactttcgccccggc
tttttcatcggcgtcagcacggtggtgctcaagcttttttcatgcgtctatgccggcaag
ccgtcgggcgtggccgctttcggcaaaaaggactaccagcaggtgctggtggtgcgccgc
atggtgcagcagtttgccctgccaatcgaaatcctggccggtgagacccagcgtgcggcg
gacgggctggcgctgtcatcacgcaacagctacctgagccccaacgagcgcattgaagcg
gcgcaactgtccaaagccctgaaggcgcttggcgatgccgcccgggccacgccaacgccc
gacctgctggcgctggaagcccaggccatgcaggcgctggcacgccgcggctggaagccc
gactacctgaccgtgcgccgccgcgctgacctgcagccaccgcaggggccgctggcttca
gagccgctggtggtgctgggtgcggccaaactgggcaacacccgtctgattgacaacctg
gaaatttga

DBGET integrated database retrieval system