KEGG   Polaromonas sp. JS666: Bpro_1176
Entry
Bpro_1176         CDS       T00343                                 

Definition
(GenBank) Isoprenylcysteine carboxyl methyltransferase
Organism
pol  Polaromonas sp. JS666
SSDB
Motif
Pfam: PEMT ICMT NnrU DUF2852 ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: ABE43127
UniProt: Q12EB5
Position
1215783..1216433
AA seq 216 aa
MSHDQPAYGLWLLVILNSAVFILFAFSFFKPATARDWRSFGAFSAFIVALFVEMYGFPLT
LYLLSGWLQTRYPGLDILSHDTGHLWSTLLGAKGDPHFGPLHIASYVFLGGGFWLLSSAW
NVLYHAQRSGALATTGPYARIRHPQYLAFVLIMLGFLFQWPTVLTLVMFPILLAMYGRLA
ITEEAEMRAQFGDAYERYARRTPRFLPRWGHVSSAG
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagccacgatcaaccggcctacgggctgtggctgctggtcatcctcaactcggccgtc
ttcatcctgtttgccttcagcttcttcaagccggccacggcgcgcgactggcgaagcttc
ggggcattctccgccttcatcgtggccctgtttgtcgagatgtacggattcccgctgacc
ctttacttgctgtcggggtggctccagacccggtatccggggctggacatcctgtcccat
gacaccggtcacctgtggtcgacgctgctgggcgccaaaggtgatccgcacttcggaccg
ctgcacatcgccagctatgtcttcctcggcggcggcttctggctgctgtccagcgcgtgg
aacgtgctctaccacgcccagcgtagcggcgcactggcgaccaccggcccgtacgcgcgg
atccgacatccacagtaccttgcctttgtgttgatcatgctgggctttctgtttcagtgg
cctaccgtgctcacgctggtgatgtttccgattctgctcgccatgtacgggcgtctggcg
atcactgaagaagcggaaatgcgtgcgcaattcggcgacgcctatgaacgctacgcccgg
cgcacaccccggttcctcccccgctggggtcatgtttcaagcgcaggctag

DBGET integrated database retrieval system