KEGG   Polaromonas sp. JS666: Bpro_1294Help
Entry
Bpro_1294         CDS       T00343                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00900  Terpenoid backbone biosynthesis
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpro_1294
Enzymes [BR:pol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bpro_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABE43244
UniProt: Q12DZ8
Position
complement(1336334..1337263)
Genome map
AA seq 309 aa AA seqDB search
MTRTASAPRSVGSARPLKAIYDVPAPAKLNLFLHITGRRADGYHLLQSAFMLIDWCDTLH
FELRTDGQISRADLSDPGSPGCGAAEPLPAEDLAVRAARALQAACGTSLGVHIGLEKRIP
SQAGMGGGSSDAASCLLALQRLWGVTLPATELRALALSLGADVPFFLSGGHAWVEGIGEK
ITPIALPAARFVVVKPSAGLSTPAIFSAPELKRDTETATIQGFAANAEGQVFGFGRNDLQ
PVAQALCPPIGQSLDWLSAQHLQGRMTGSGSAVFALLPHDVDLSDVPGTPGDWKIRKCSN
LQAHPLAGW
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcactgccagcgctcctcgttccgtgggttcagcacgcccactcaaagccatt
tacgacgttcccgccccggccaagctcaacctgtttttgcacatcacgggccggcgggcc
gatggctaccacctgctgcagtcggccttcatgctgatcgactggtgcgacaccctgcac
tttgaactgcgcaccgatgggcagatcagccgcgccgacctgagcgatccaggcagtccc
ggctgcggcgcagcagaacccctgccagcagaagatcttgccgtgcgggcggccagggcc
ctgcaggcagcgtgcggcacctcactgggtgttcacatcggtctggaaaaacgcataccg
tctcaggcgggcatgggcggcggctcgtccgacgcggcgagctgcctgctggcactgcaa
cgcctctggggcgtaacgttgcctgccacggagttgcgcgcgctggccctgtcgctgggc
gcggacgtgccttttttcctctcgggcgggcatgcctgggtcgaagggatcggcgagaaa
atcacccccatcgcgctgccggcggcgcggtttgtggtggtcaagccttcggccgggctc
tctacgcccgctattttcagtgcgccggaactcaaacgcgatacagaaactgctacaatc
caaggctttgctgcaaatgcagaaggtcaggtcttcggatttggccgcaacgacttgcag
ccggtcgcccaggcactgtgtccgccgattggtcaatcactcgattggctgtcagcgcaa
caccttcagggacgaatgaccggctcgggaagtgctgtgtttgcgctactgccgcacgat
gtggatctgtcagatgtaccaggaactcctggtgactggaaaatccgcaagtgcagcaat
ttgcaagcgcatcccctggccggttggtaa

DBGET integrated database retrieval system