KEGG   Polaromonas sp. JS666: Bpro_2049Help
Entry
Bpro_2049         CDS       T00343                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00010  Glycolysis / Gluconeogenesis
pol00620  Pyruvate metabolism
pol00640  Propanoate metabolism
pol00680  Methane metabolism
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpro_2049
   00620 Pyruvate metabolism
    Bpro_2049
   00640 Propanoate metabolism
    Bpro_2049
  Energy metabolism
   00680 Methane metabolism
    Bpro_2049
Enzymes [BR:pol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bpro_2049
Lipid biosynthesis proteins [BR:pol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bpro_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABE43979
UniProt: Q12BW3
Position
2129728..2131725
Genome map
AA seq 665 aa AA seqDB search
MSSAPSNIESVLVENRVFPPGPATVKAARISGMEAYNAMCREADKDFDRFWARLARDNLS
WKKPFSQVLDESNAPFYQWFADGELNASYNCLDRHLGTPTESKKAIIFESDDGKATSVTY
KELHARVSQFASALKGLGVKKGDRVIIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKS
LQERIQDAGAVAVITANYQLRGGKELPLKAIVDEGIAMGGCESIKNVVVYQRTATPCNMV
AGRDSLMHEITARAAATCEPEFVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKLTMD
WTFDIQPADVFWCTADIGWITGHTYVAYGPLAAGATQVIFEGIPTYPNAGRFWQMIEKHK
VTIFYTAPTAIRSLIKAAEGDEKIHPARSDLSSLRILGTVGEPINPEAWMWYYKNIGGER
CPIVDTFWQTESGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGKDLPNGSGGLLVV
KRPWPSMIRGIWNDPERFKKSYFPEEMGGTMYLAGDGAVRNADNGYFRITGRIDDVLNVS
GHRMGTMEIESALVAHSTLVAEAAVVGRPDDLTGEAIVAFVVLKRSRPTGDEAKAIAKEL
RDWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRGIAKGEALTQDTSTLENPAILDQ
LSENL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgccccgtcgaacatcgagtccgtgctggttgaaaaccgcgtatttcccccc
gggccggctaccgtcaaggccgcccgcatttccggcatggaggcttacaacgcgatgtgc
cgggaggccgacaaggattttgaccgcttctgggccaggctggccagggacaatctcagc
tggaaaaaacctttcagccaggttctggacgagtccaatgcaccgttttaccaatggttt
gccgatggtgaactgaacgcctcctacaactgcctggaccgccacctgggtacgccgaca
gagagcaagaaggccattattttcgagagcgatgatggcaaggcgaccagcgtcacttat
aaggaactgcatgccagggtcagtcagtttgccagtgcgctcaagggcctgggggtgaag
aagggcgaccgcgtcatcatctacatgccaatgaccattgaaggcgttgttgccatgcag
gcctgtgcccgcattggtgccacgcactcggtggtgttcggtggtttctcggccaagagc
ctgcaggagcgcatccaggacgccggtgcagtcgcagtcattaccgccaactaccagttg
cgcggcggcaaggagctgccgctcaaggcgattgtggacgaaggcatcgccatgggcggc
tgcgagtcgatcaagaacgtggtggtctaccagcgcaccgccacgccctgcaacatggtg
gccgggcgcgacagcctgatgcacgagatcaccgccagggccgcagccacctgcgagccg
gaatttgtgggcgccgagcatccgctgttcatcctgtacacgtcgggctccaccggcaag
cccaagggcgtgcagcacagcacgggcggctacctgctgtgggccaagctcaccatggac
tggacctttgacatccagcccgccgatgtgttctggtgcaccgccgacatcggctggatc
accggccacacctatgtggcgtatggcccgctggccgctggtgcgacgcaggtcatcttt
gaaggcattccgacttacccgaacgccggccggttctggcagatgatcgagaagcacaag
gtcacgattttttacacagcacccaccgccatccgttcactgatcaaggccgctgaaggc
gatgaaaaaatacacccggcccgctcggatctgagcagcctgcgcattctgggcacggtg
ggcgaacccatcaaccccgaggcctggatgtggtactacaaaaacattggtggcgagcgc
tgcccgattgtggataccttctggcaaaccgagtcgggcggacacatgatcacgccgctg
cccggcgcgacgccgctggttcctggcagctgcaccttgccgctgcccggcatcatggcc
gccatcgtcgacgaaaccggcaaggacttgcccaacggctcgggcggcctgctggtggtc
aaacgcccgtggccgtccatgattcgcggcatctggaatgaccccgagcgcttcaagaag
agctactttccggaagaaatgggcggcacgatgtacctggccggcgacggcgcggtccgc
aatgctgacaacggctatttccgcatcaccggccggattgacgatgtgctgaatgtgtcg
ggccaccgcatgggcaccatggaaatcgaatcggcactggtggcgcactcgaccctggtg
gcggaggctgccgtggtaggccgccctgatgacctgaccggcgaggcgatcgtggcgttt
gtggtgctcaagcgctcgcggcccacgggcgatgaggccaaggcgattgccaaggagctg
cgcgactgggtcggcaaggagattggcccgattgccaagcccaaggacatccggtttggt
gacaacctgcccaagacgcgcagcggcaaaatcatgcgccgcctgttgcgcggcattgcc
aagggtgaggctcttacgcaggacacctcgacgctggagaatccggcgatcctcgatcag
ttgtctgaaaacctctga

DBGET integrated database retrieval system