KEGG   Polaromonas sp. JS666: Bpro_2140Help
Entry
Bpro_2140         CDS       T00343                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00071  Fatty acid degradation
pol00072  Synthesis and degradation of ketone bodies
pol00280  Valine, leucine and isoleucine degradation
pol00310  Lysine degradation
pol00362  Benzoate degradation
pol00380  Tryptophan metabolism
pol00620  Pyruvate metabolism
pol00630  Glyoxylate and dicarboxylate metabolism
pol00640  Propanoate metabolism
pol00650  Butanoate metabolism
pol00900  Terpenoid backbone biosynthesis
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
pol01212  Fatty acid metabolism
pol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpro_2140
   00630 Glyoxylate and dicarboxylate metabolism
    Bpro_2140
   00640 Propanoate metabolism
    Bpro_2140
   00650 Butanoate metabolism
    Bpro_2140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bpro_2140
   00072 Synthesis and degradation of ketone bodies
    Bpro_2140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpro_2140
   00310 Lysine degradation
    Bpro_2140
   00380 Tryptophan metabolism
    Bpro_2140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpro_2140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_2140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bpro_2140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pol04147]
    Bpro_2140
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bpro_2140
Exosome [BR:pol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bpro_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABE44067
UniProt: Q12BM5
Position
2231368..2232546
Genome map
AA seq 392 aa AA seqDB search
MEDIVIVSAGRTAVGKFGGSLAKMPATELGAAVIKAVLERSGLSAEQVGEVILGQVLAAG
VGQNPARQAVIKAGFPHGIPGLTINAVCGSGLKAVMLAAQSVATGDSEIVIAGGQENMSA
APHVLNGSRDGQRMGDWKMIDSMIVDGLWDVYNQYHMGITAENVAKKYGIDRESQDALAL
ASQTKAAAAQDAGKFKDEIIPISIPQKKGDPLVFAADEFINRKTNAEGLAGLRPAFDKAG
GVTAGNASGLNDGAAAVMVMTAKKAAALGLKPLARIASYATTGLDPAYMGMGPVPASTKA
LKRAGWKAQDLDLLEINEAFAAQACAVNKEMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMARRDAKKGIASLCIGGGMGVALTLER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacattgttatcgtttcagcaggccgcacggccgttggaaaatttggcggttcc
ctggcgaaaatgcctgcaaccgaacttggcgcggccgtgatcaaggcggtgctcgagcgt
tccggcctgagcgccgaacaggtgggcgaagtcatcctcggccaggttttggccgccggg
gtgggacagaatccggcgcgccaggccgtgatcaaggcgggcttcccgcatggcattccg
ggactgacgatcaatgccgtttgcggctccggcctcaaggcggtcatgttggcggcgcag
tctgtggcgactggtgacagcgaaatcgtcattgccggtggtcaggagaacatgagtgcg
gcgccgcacgtgttgaacggctcgcgggacggccagcgcatgggcgactggaagatgatc
gattcgatgattgtggatggcctgtgggacgtctacaaccagtaccacatgggcatcacc
gccgagaatgtcgccaagaaatacggcattgaccgtgagtcgcaggacgcgctggcgctg
gccagtcagaccaaggccgccgctgctcaggacgccggtaaattcaaggacgagattatt
ccgatttccattccgcagaaaaaaggcgacccgctggtgtttgcggccgacgagttcatc
aaccgaaaaaccaatgcagagggcctggccggcctgcgccccgcctttgacaaggccggt
ggcgtcacggcaggcaatgcctcgggcctgaacgacggtgcggcggcggtgatggtcatg
acagccaaaaaggctgccgcgctcggcctgaagccgctggcgcgtattgcaagctacgcc
acgaccggcctggacccggcctacatgggcatgggcccggttccggcatcgaccaaggcg
ctgaagcgcgccggctggaaggcgcaggatctggacttgctggagatcaatgaagccttt
gccgcacaggcctgcgcagtgaacaaggaaatgggctgggacaccagcaaggtcaacgtc
aatggcggtgctattgccatcggccacccgattggtgcctccggttgccgcatcctggtg
acgctgctgcacgagatggcgcgacgcgatgccaaaaaaggtattgccagcctgtgtatt
ggcggtggcatgggggtggcactcacactggagcgctga

DBGET integrated database retrieval system