KEGG   Polaromonas sp. JS666: Bpro_2705Help
Entry
Bpro_2705         CDS       T00343                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00072  Synthesis and degradation of ketone bodies
pol00650  Butanoate metabolism
pol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bpro_2705
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bpro_2705
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bpro_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ABE44621
UniProt: Q12A21
Position
2850896..2851678
Genome map
AA seq 260 aa AA seqDB search
MLKGKTALVTGSTSGIGLGIAKSLAAQGANIVLNGFGDVDGPKAEILALGVKVAYHGADM
SKPADIEDMMKFAASQFGQVDILVNNAGIQHVARVENFPVEKWDAVIAINLTSAFHATRL
ALPAMLAADNGKGWGRIINIASVHGLVGSAEKSAYVAAKHGIVGLTKVTALENATSGVTC
NAICPGWVLTPLVQKQVDARAAAGNISIEAATQQLLGEKEPSMRFTTPEELGALAVFFCS
AAGNNVRGVAWNMDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaggtaaaacagctctcgttaccggctccaccagcggcatcggcctgggcatt
gccaaatccctcgccgcacagggcgccaacatcgtcctcaatgggtttggcgatgtggac
gggcccaaggcggagatcctggcgctcggcgtcaaggtggcctaccacggtgccgacatg
agcaagcccgcagacattgaagacatgatgaaattcgccgcctcgcagttcgggcaggtc
gacattctcgtcaacaacgcgggcatccagcatgtggcccgggtagaaaacttcccggtt
gaaaaatgggatgcggtcatcgcgatcaacctgaccagcgcctttcatgccacacgcctg
gcgctgcccgccatgctggccgcggacaatggcaagggctggggccgcatcatcaatatc
gcctcggtgcatggcctcgtcggctccgcggaaaaatcagcctatgtggcggccaagcac
ggcattgtcggactgaccaaggtcaccgcgcttgagaacgccaccagcggcgtgacctgc
aacgccatctgccccggttgggtgctgacacccctggtacaaaaacaggtggatgccagg
gctgcggcgggaaatatttccatcgaggcagccacccagcagctgctgggtgaaaaagaa
ccttcgatgcgattcaccacgcccgaagaactgggcgcgctggcggtgttcttctgctct
gcggcgggcaacaatgtacgcggcgtcgcgtggaacatggacggcggctggacggcgcag
taa

DBGET integrated database retrieval system