KEGG   Polaromonas sp. JS666: Bpro_2958Help
Entry
Bpro_2958         CDS       T00343                                 

Definition
(GenBank) Enoyl-CoA hydratase
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABE44872
UniProt: Q129C0
Structure
PDB: 

Position
3119453..3120232
Genome map
AA seq 259 aa AA seqDB search
MAGAIKSTSEGQTLILTLSNPEFRNALGPEIYAAGIEALNAAENNPEIRSVVITGEGAVF
CAGGNLQRLQANRREAPEVQAQSIEGLHNWIDSIRTYPKPVIAAVEGAAAGAGFSLALAC
DFVVAASNAVFVMSYSTVGLSPDGGGSWSLARSLPRALASELLMGGERISAQRLHDLGLV
NKVASAGDALSEALRMAGQLNARAPNALASIKELINEASSNTLSQQLACERDHFVRNLHH
SNGGEGIAAFLGKRTPQYR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgcaatcaaaagtaccagtgagggccagaccctcatcctgacgctgagcaac
cccgagttccgcaatgcgctggggccggagatttacgccgcaggcattgaggccctcaat
gccgccgagaacaaccccgaaatccgcagcgtggtgatcaccggcgagggcgcggtgttt
tgcgcgggcggcaacctgcagcgcctgcaagccaaccggcgtgaggcacccgaggtccag
gcccagagcatcgaagggctgcacaactggattgactcgatacgcacttatcccaaaccc
gtgatcgccgcagtcgaaggtgcggcggccggggccggcttttcgctggcactggcctgc
gactttgtcgtcgccgcaagcaacgctgtgtttgtgatgtcctacagcacggtcgggctg
tcccccgacggtggcggcagctggagcctggcgcgctctctgccacgcgcccttgccagc
gagctgctcatgggcggcgaacgcatcagcgcccagcgcctgcatgacttgggcctggtg
aacaaggtcgcatccgcgggtgatgccctgagtgaagcgctcaggatggccgggcaactc
aatgcgcgcgcgcccaatgcgctggccagcatcaaggagctcatcaatgaggcgtcctca
aacaccctgagccagcaactggcctgcgagcgcgaccatttcgtgcgcaacctgcaccac
agcaatggcggcgagggcatcgccgcattcctgggaaagcgcacaccgcagtaccgctga

DBGET integrated database retrieval system