KEGG   Polaromonas sp. JS666: Bpro_2959Help
Entry
Bpro_2959         CDS       T00343                                 

Definition
(GenBank) transcriptional regulator, Crp/Fnr family
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
pol  Polaromonas sp. JS666
Pathway
pol02020  Two-component system
pol02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pol00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bpro_2959
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bpro_2959
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pol03000]
    Bpro_2959
Transcription factors [BR:pol03000]
 Prokaryotic Type
  Helix-turn-helix
   CRP/FNR family
    Bpro_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 GntR MarR_2 HTH_24 TrmB
Motif
Other DBs
NCBI-ProteinID: ABE44873
UniProt: Q129B9
Position
3120528..3121253
Genome map
AA seq 241 aa AA seqDB search
MDDPILTIDERAAINSGRWFSSLSPSLRHDILRCAYVKRYKDGELIAARGDPPEEWIACA
KGAVRVSSTSLSGKQITLTYVEPGIWFGDVAIFDGDRRTHDAYAHGDTTILCVAKADFRK
ILAAHVELYEAMLRLHARRLRQLFGLVEDLNTLPLRARLAKQLLHLVRCYGVPSLADGQE
IRIGLQLAQEELAQLLGASRQRVNQELKSMEREEAIRIEPGGLVVRNREALMRISEADMD
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcctattcttacgatagatgaaagagcggccatcaacagtggtcgctggttt
tcatcactgtccccgtccctgaggcacgacatcctgcgatgcgcttacgtcaaacgctac
aaagacggcgaattgattgccgcccgcggcgatccgccggaagaatggattgcctgcgcg
aagggagccgtgcgcgtaagctccacctccctctcgggcaagcagatcaccctgacctat
gtcgagccaggcatctggtttggcgacgtggcgattttcgacggcgaccgccgcacgcac
gacgcgtatgcgcacggcgacaccacgatcctgtgcgtggccaaggccgatttcagaaaa
attctggcagcccatgtggagctctacgaggccatgctgcggctccatgcacggcgcctg
cgtcagctcttcggcctggtggaagacctcaacaccctgcccctgcgcgcgcgcctggcc
aagcagctgttgcacctcgttcgctgctacggcgtgcccagcctggccgacggccaggag
atacgcatcggcctgcagctggcccaggaggagttggcccagttgctgggtgcctcccgc
cagcgcgtcaaccaggagctcaagtccatggagcgcgaggaggcgatccgcatcgagcca
gggggcctggtggtgcgaaaccgcgaagccctgatgcgcatctccgaagccgatatggac
aaataa

DBGET integrated database retrieval system