KEGG   Polaromonas sp. JS666: Bpro_2960Help
Entry
Bpro_2960         CDS       T00343                                 

Definition
(GenBank) aminoglycoside phosphotransferase
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH EcKinase Choline_kinase
Motif
Other DBs
NCBI-ProteinID: ABE44874
UniProt: Q129B8
Position
3121258..3122349
Genome map
AA seq 363 aa AA seqDB search
MSNFDHFVGTRAVSGQQAFDIDVLSTYLKQHLEGFEGPLTVEIFKGGQSNPTYKLITPGR
SYVMRAKPGPVARLLPSAHAVEREFKVMQGLQGTDVPVARMHCLCEDESVIGRAFYVMEF
VEGRVLWDQSLPGMTNTRRGEIYDEMNRVIAALHTVRFAERGLADYGKPGNYFERQIGRW
SKQYAASITQPIPEMDSLIQWLPANIPAGARDDSMVSIVHGDFRLDNLMFHPTEPRVLAV
LDWELSTLGHPLADFSYHCMAWHIPPGAFRGIGGLDIASLGIPSEAEYIRRYCERTGLAT
PEALKADWNFYLAYNLFRLAAILQGIAKRVEAGTASSAQAVSSAAGAPLLAGMAWRFALE
SQR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttcgaccattttgtaggcacccgggccgtttccgggcagcaggcttttgac
atcgacgtcctcagcacctatctgaaacagcacctcgagggtttcgaaggaccgttgacc
gtcgagatattcaagggtggccagtccaacccgacctacaagctgatcacaccggggcgg
tcttacgtcatgcgggccaaaccgggccctgtggccaggctgctgccgtcggcccacgcg
gtggagcgcgaattcaaggtcatgcagggcctgcagggcaccgacgtgcccgtcgccagg
atgcactgcctgtgcgaagacgagtccgtgatcgggcgggctttttatgtgatggagttc
gtcgagggccgggtcctctgggaccagtccctgcccggcatgaccaacacccggcgcggc
gagatctatgacgagatgaaccgcgtgatcgccgccctgcacaccgtgaggtttgcggaa
cggggcctggccgattacggcaagcccggcaactactttgagcgccagattggccgctgg
agcaagcagtacgcggcatccattacccaaccgattcccgagatggattcgctgatccag
tggctgccagccaatatccctgccggcgcgcgcgatgacagcatggtctccatcgtgcac
ggcgacttccggctcgacaacctgatgtttcatcccaccgagccgcgcgtactggcggtg
ctcgactgggagctgtccaccctgggccatccgctggcagacttcagctaccactgcatg
gcctggcacataccaccgggcgcgtttcgcggcattggcggcctggacatcgccagcctg
ggcattccttcggaagccgaatacatccgccgttattgcgagcgcaccggcctggccaca
cccgaagccctcaaggccgactggaatttctaccttgcctacaacctgtttcgcctcgca
gcgattttgcagggcattgccaaacgggtggaagccggtaccgcctccagcgcgcaggcg
gtcagctcggcagcgggtgcaccgctgctggccgggatggcctggcgctttgcgcttgaa
agccagcgctga

DBGET integrated database retrieval system