KEGG   Polaromonas sp. JS666: Bpro_2970Help
Entry
Bpro_2970         CDS       T00343                                 

Definition
(GenBank) hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TubC_N
Motif
Other DBs
NCBI-ProteinID: ABE44884
UniProt: Q129A8
Position
3130116..3130448
Genome map
AA seq 110 aa AA seqDB search
MTPESILELLWAQGFTVCLVERYRLAVSPASTLQDSQRELLRANKAAIVAALREADSIIA
DLLKAAMLACDHHGDNPAAREAMCADCLATPPHLRADLLAHFKQTYRGQA
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagaatccattctggaactgctttgggcgcaagggttcaccgtctgccttgtg
gaacgctacaggctggccgtcagccctgccagcaccctgcaagacagccagcgcgaattg
ttgcgggccaacaaagccgccatcgttgccgcactgcgcgaggccgacagcatcatcgcc
gatctgctcaaagccgccatgctggcctgcgaccaccacggcgacaaccctgcggcgcgg
gaggccatgtgcgccgattgcttggcaacaccgccacacctccgcgccgacctgctggcg
catttcaaacaaacctatagaggccaagcatga

DBGET integrated database retrieval system