KEGG   Polaromonas sp. JS666: Bpro_2971Help
Entry
Bpro_2971         CDS       T00343                                 

Definition
(GenBank) hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terminase_4
Motif
Other DBs
NCBI-ProteinID: ABE44885
UniProt: Q129A7
Position
3130689..3131093
Genome map
AA seq 134 aa AA seqDB search
MARPRKPTSVLELTGSFKAHPERAAARKSEPVPSGEIGDAPSYFDDESRKCWTEIVGMCH
VGTLCAADRLIVEHGARVLAALRASPVYADAKLMIRLEATLGKLGLTPADRSKVQVIKPK
GNTNPFLRNGAGRR
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaccacgcaaacctacaagtgtgcttgagctgacaggctctttcaaggcccat
cccgagcgggcggcggcacgcaagtcagagcctgtgccttcgggtgaaatcggtgacgca
ccaagctattttgatgacgaatcccgcaaatgttggacagagattgtcggtatgtgccat
gtcggcacgttatgcgcggctgaccgtttgattgttgagcatggcgccagggtgcttgcc
gccttgcgggccagtccagtctatgcagacgcaaagttgatgatccgtcttgaggctact
ttggggaaattgggtctgacgccggccgaccgctcaaaagtccaagtcatcaagcccaag
ggaaatacgaacccgtttttacgcaacggagcgggcaggcgatga

DBGET integrated database retrieval system