KEGG   Polaromonas sp. JS666: Bpro_2972Help
Entry
Bpro_2972         CDS       T00343                                 

Definition
(GenBank) hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABE44886
UniProt: Q129A6
Position
3131090..3131347
Genome map
AA seq 85 aa AA seqDB search
MSTPPNPMERLPELPSEIDPTAAGLWAASILFQAALTRGWDREKLRFLTFTLVVGVAVGD
LTDAELHAEFQTAIDAARSHGAVKQ
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccaccgaaccccatggagcggctgcccgagctgccgagcgaaattgacccg
accgccgccggcctttgggcggcatcgattctctttcaagccgcactgacccgaggatgg
gaccgcgagaaattgcgattcctaacgttcacgctcgtcgtgggggttgcggttggcgac
ctgaccgacgccgagctgcatgccgagtttcagaccgctattgatgcggcgcgctcgcac
ggtgcggtgaagcagtaa

DBGET integrated database retrieval system