KEGG   Polaromonas sp. JS666: Bpro_2974Help
Entry
Bpro_2974         CDS       T00343                                 

Definition
(GenBank) conserved hypothetical protein, putative major phage head protein/prohead proteinase
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_capsid
Motif
Other DBs
NCBI-ProteinID: ABE44888
UniProt: Q129A4
Position
3131730..3132812
Genome map
AA seq 360 aa AA seqDB search
MYENTNFPPRGSGVVRALISNILAQKNAEGPVGALRIAEQRWGKGSEVAVITRAAVAGGS
TASGAWGAELEAQSAVAEFLEIVTPMTILGRTANLRRVPVGVPVVKQTGAATGYWVAQGK
ATPLSSMAFDRTTLEAKMRVGAIVVVSNDLLEAPGGDEVLRGDLALAVASATDAAFIDHQ
NAGVAGEKPPGIAYGMPAIPASGSDAATFKVDIANALEAFTGSLMNAVWVMHPRAAAAIG
LLMGAAGVACNLGARGGELAGLPVLTSELVEITTDGTAITLFDASSVLITEGTLIMGKNS
DGAVEMDNEPTGDGTPTAATTLVPLWQTESTGLKVGRHIEWELGRPGAAVVITGVPFGAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaaacacgaactttccaccccgcggctccggcgtcgtgcgcgcgttgatctcg
aacatactcgcgcaaaagaatgccgaagggccagtcggcgcactgcgcattgctgagcag
cgctggggcaagggcagtgaagtggctgtcatcacacgcgcagcggttgcaggtggaagc
acagccagcggcgcctggggcgccgagcttgaagcccaatctgctgttgctgaattcctg
gagatcgtgacgcctatgaccatcctcggacggacggcgaacttgcgccgggtgccagtg
ggtgtgccagtggtgaaacaaaccggcgctgcgaccggctactgggtcgcacaaggcaag
gcgaccccgttgagcagcatggcatttgatcgcacgacgctcgaggccaaaatgcgcgtc
ggcgcgatagtggtggtctcaaatgacttgctggaggcaccaggcggcgacgaggtgttg
cgcggcgacctggccctggccgtagcaagcgccactgacgcggcattcatcgaccaccag
aatgcaggcgtggctggcgaaaagccgccggggatcgcttacgggatgcccgcgatccct
gcctcgggcagcgatgccgcaacgttcaaggtggacatcgccaacgcgctcgaggccttc
acgggctccctgatgaacgcggtctgggtcatgcatcctcgggcagccgcggcaatcggg
ctgttgatgggtgcggcgggcgtggcctgcaacttgggcgcccgcggtggcgagttggcc
ggcctgcccgtcctgaccagcgagctcgtggaaatcaccacggacggcaccgcgattacc
ctctttgacgcctcgtcggttttgatcaccgaaggtacgctgatcatgggaaaaaactcc
gacggcgccgtggaaatggacaacgagccaacgggcgacggcacgccgaccgccgcgacc
accctggtcccactctggcaaaccgaatctaccggcctcaaggtggggcgccatatcgaa
tgggagctcggccggccaggcgctgctgtggtcattactggtgttcctttcggggcgctc
tga

DBGET integrated database retrieval system