KEGG   Polaromonas sp. JS666: Bpro_2976Help
Entry
Bpro_2976         CDS       T00343                                 

Definition
(GenBank) hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABE44890
UniProt: Q129A2
Position
3133640..3134260
Genome map
AA seq 206 aa AA seqDB search
MPIRHEGVFSLSNSSYSVGKFLGRNWLGLLVAACFFALWGYLDSRPVEQPTSPVTAQKQG
TQDIQAAKEKRDEEERLRRCTTESAALRAEAKALMKAKDPQKAFELLAPCRNLPIDQDTT
KLITEVLTATRANDEIRIKREALAEKSRRKKEGVSIGMTQQEVLDSSWGRPQRINKTTSA
NYQHEQWVYDGGYLYFESGILKTIQH
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgcccataagacatgagggagtattcagcttgagcaattcgtcctattccgtcggcaaa
ttcctcggcagaaattggcttgggcttttagtggcggcctgcttcttcgcgctatggggg
tatctggacagccggccagtagaacaacccacctcgccagtcaccgcacagaaacagggc
actcaggatatacaggcagcgaaagaaaaacgcgacgaagaagaacggctacggagatgc
acaacggaaagcgcagcacttcgcgcggaggctaaagccttgatgaaagccaaagatccg
caaaaggctttcgaactactcgccccatgccgaaatttacccatcgaccaagacaccacg
aaattaataacggaggtgctgaccgcaacccgggcaaacgatgaaattcggataaaaaga
gaagctctcgccgaaaaatcacgccgcaaaaaagagggtgtcagcattggtatgacgcag
caggaagtcttagacagcagctggggcaggcctcaacggatcaataagactacttcagca
aactatcagcacgaacagtgggtctacgacggcggctacctgtactttgaaagtggaatt
ctgaaaacgattcaacattag

DBGET integrated database retrieval system