KEGG   Polaromonas sp. JS666: Bpro_2981Help
Entry
Bpro_2981         CDS       T00343                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF488 DUF4326
Motif
Other DBs
NCBI-ProteinID: ABE44895
UniProt: Q128Z7
Position
3136511..3136909
Genome map
AA seq 132 aa AA seqDB search
MTVRIVKLGTARGADEGLRIGTVRRPPRGVPKSQFSSQNWYDVWYPNLAPSVETMKLGQS
AQAGPDGDRDWVAFRKKYRAEMAEPDANRSLDLLAALSQRSNFSVGCYCDNEARCHRSLL
RELLRERGANIA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgaggatcgtcaaattgggtacagcccgcggcgccgacgaaggcctgcgcata
ggcacggtccgcagacctccccggggcgttcccaaaagccagttctcgtcacagaattgg
tacgacgtctggtaccccaacctcgcgccgagtgtggaaaccatgaaactgggccagtcg
gcccaggctggccccgatggtgaccgggactgggtcgcgttcagaaagaaataccgcgcc
gagatggccgaaccggacgccaaccgcagcctggacctgctggccgcgctgtcgcagcgc
agcaatttttccgtgggctgttactgcgacaacgaagcgcgctgccaccgctcgctgctg
cgcgaactgctccgcgaacgcggcgcaaatatcgcttaa

DBGET integrated database retrieval system