KEGG   Polaromonas sp. JS666: Bpro_2983Help
Entry
Bpro_2983         CDS       T00343                                 

Definition
(GenBank) benzoate-CoA ligase
  KO
K04110  benzoate-CoA ligase [EC:6.2.1.25]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00362  Benzoate degradation
pol00627  Aminobenzoate degradation
pol01100  Metabolic pathways
pol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_2983
   00627 Aminobenzoate degradation
    Bpro_2983
Enzymes [BR:pol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.25  benzoate---CoA ligase
     Bpro_2983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABE44897
UniProt: Q128Z5
Position
3137613..3139199
Genome map
AA seq 528 aa AA seqDB search
MQLSRADHSASPPLVDIPRDYNAAHDLLERNAQRPDKVAFINGLSGEQLTYGELARQSHG
FANALRNQGFAPESRVLLAMLDTPEWPVAFLGCILAGVVPVAANTLLTTQDFEFMLRDSR
AQGLIVSEALLPAFEPLLGRVDTLKAVIVSGAETSTPHMTLAQLLRASPATKSIANTCAD
EACFWLYSSGSTGTPKGTVHLHSHLIQTAELYGRGVLGIQESDVVYSAAKLFFAYGLGNA
LTFPMSVGATTVLLPARPTPAEVFGLLKKYQPTIFYGVPTLYAALLADPARPAKSELRLR
ICTSAGEALPAEIGKKWTAQYGCDILDGIGSTEMLHIFLSNRPGEVRYGTTGQAVPGYSL
RIVADDGHECGVGEIGELQISGPSAALMYWNNRAKTKATFAGEWTRSGDKYTRDADGFYT
YGGRSDDMLKVGGIYVSPFEVEACLMGHASVLEVAVIGVMDADQLVKPKAYVVMKSGQSA
TAGELQAHVKQLLAPYKYPRWIEFVSELPKTATGKIQRFKLRQTQQAR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgagtcgcgccgaccattcggcaagccctcccctggtagacattccccgtgac
tacaacgccgcgcacgacctgctcgagcgcaatgcgcagcgccccgacaaggtcgctttc
atcaacggcctgagcggggagcaactcacctacggcgaactcgcccggcaatcccatggt
tttgccaatgccctgcgaaaccagggcttcgcacctgaaagccgcgtcctgctggcgatg
ctggacacccccgagtggcccgttgccttcctgggctgcatcctggctggcgtggttccc
gtggctgcaaacaccctgctcacgacccaggacttcgagttcatgctgcgcgactcgcgc
gcccaggggctcatcgtctcggaggccctgctgccggcctttgagccgctgctgggcaga
gttgacacactcaaggccgtgatcgtctcgggcgccgaaacttccacgcctcacatgacg
ctggcccagcttctgagagcatctccggctactaaatctatcgcaaacacatgcgccgac
gaggcttgcttctggttgtattccagcggctcgacgggaacgcccaagggcacggtccat
ctgcacagccacctgatccagaccgccgaactgtatggccggggggtgctggggatccag
gaatccgatgtcgtgtattccgccgccaaactgttttttgcctatggcctgggcaatgcg
ctgaccttcccgatgagcgtcggcgccaccacggtgctgctgccagcacgccccacgccg
gccgaggtgtttgggctgctcaagaaataccagcccacgatcttctatggcgtacccacg
ctctatgccgcgctgctggcagacccggcccggccggcgaaatccgaactccgcttgcgc
atttgcaccagcgccggtgaagccctgccggccgagattggcaagaaatggacggcgcag
tatggctgtgacatcctggacgggattggctcgacggaaatgctgcatattttcctgagc
aaccggcccggcgaagtgcgttacggcaccaccggtcaggccgtgccaggctactcgctg
cgcatcgtcgccgacgatggccacgaatgtggcgtcggcgagatcggcgagcttcagatc
agcggcccgagcgctgccctgatgtactggaacaaccgcgccaaaaccaaggccaccttt
gccggcgaatggaccaggagcggcgacaagtacacgcgcgacgccgacggcttctacacc
tacggcggacgcagcgacgacatgctcaaggtgggcggcatttatgtctcgccgttcgag
gtggaagcctgcctcatgggccacgcatctgtactcgaggtcgcggtgatcggtgtgatg
gacgccgatcagctggtcaaacccaaggcttatgtggtgatgaagtccggccagagcgca
accgccggggagctgcaggcccacgtcaagcagctgctggcgccctacaagtacccgcgc
tggatagagtttgtgagcgagttgcccaaaaccgcgaccggcaagatacagcgcttcaag
ctgcgccagacccagcaagccagataa

DBGET integrated database retrieval system